Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3ATD2

Protein Details
Accession A0A2H3ATD2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-24IVKACPKQRNGKIKNWHKYIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences LREAIVKACPKQRNGKIKNWHKYIDIAVFADRVTTSSVTGYTPYYLLHGVEPLLPMDLIEATFMVEGFQSGISTEELLALRIRQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.75
4 0.8
5 0.84
6 0.79
7 0.72
8 0.63
9 0.59
10 0.53
11 0.46
12 0.37
13 0.28
14 0.22
15 0.2
16 0.18
17 0.15
18 0.11
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.04
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.1
63 0.1
64 0.11
65 0.12