Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JWR7

Protein Details
Accession B6JWR7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-69LAAPKKRKSYSRKRMRQLAGKHydrophilic
NLS Segment(s)
PositionSequence
52-64PKKRKSYSRKRMR
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSSIARLSSGSLFKNLSSKLSFLQLPSIRILLPKFLTDLHWIDHDSILLAAPKKRKSYSRKRMRQLAGKALVNKTNINRCPICGGYKLAHNLCPMCYKNLRKEWRNSCDVINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.22
5 0.22
6 0.21
7 0.24
8 0.24
9 0.19
10 0.28
11 0.26
12 0.26
13 0.26
14 0.25
15 0.21
16 0.23
17 0.23
18 0.18
19 0.16
20 0.15
21 0.14
22 0.14
23 0.16
24 0.18
25 0.18
26 0.16
27 0.16
28 0.16
29 0.16
30 0.16
31 0.13
32 0.1
33 0.08
34 0.07
35 0.08
36 0.09
37 0.11
38 0.16
39 0.19
40 0.22
41 0.25
42 0.33
43 0.41
44 0.51
45 0.59
46 0.65
47 0.71
48 0.75
49 0.82
50 0.8
51 0.8
52 0.74
53 0.71
54 0.65
55 0.59
56 0.55
57 0.48
58 0.45
59 0.38
60 0.35
61 0.31
62 0.34
63 0.33
64 0.36
65 0.34
66 0.32
67 0.35
68 0.34
69 0.32
70 0.26
71 0.27
72 0.23
73 0.28
74 0.33
75 0.3
76 0.31
77 0.31
78 0.29
79 0.28
80 0.33
81 0.3
82 0.3
83 0.37
84 0.41
85 0.48
86 0.57
87 0.65
88 0.66
89 0.75
90 0.79
91 0.78
92 0.77
93 0.7