Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3B659

Protein Details
Accession A0A2H3B659    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
190-210DDESEKPKKKPKAEESDNVALAcidic
NLS Segment(s)
PositionSequence
136-140GKKKK
196-200PKKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MYNYPQVFFPPEPASVASLDTPIFVLGPLLREQHPPPSTQLPEPKDYSDAESDAPTEVATDVEEEIRIAIYGTIADSECITGEGDVLAPLSQAPKTPSDRKLSRLPSTGQREPRCKRDVKRGFPDQEPPSPSPPVGKKKKVLTKRMPMWCTSRALVPCETGLMRAPASDASDLPTSSPSGGKRGRGYEADDESEKPKKKPKAEESDNVALDAGWDTTESVQESQVLLDGSLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.22
4 0.17
5 0.15
6 0.14
7 0.12
8 0.11
9 0.09
10 0.09
11 0.07
12 0.07
13 0.07
14 0.09
15 0.11
16 0.14
17 0.15
18 0.19
19 0.21
20 0.29
21 0.3
22 0.29
23 0.32
24 0.37
25 0.39
26 0.42
27 0.49
28 0.44
29 0.48
30 0.49
31 0.45
32 0.4
33 0.38
34 0.35
35 0.29
36 0.25
37 0.21
38 0.19
39 0.18
40 0.16
41 0.15
42 0.1
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.05
78 0.05
79 0.06
80 0.08
81 0.12
82 0.18
83 0.24
84 0.29
85 0.37
86 0.39
87 0.42
88 0.48
89 0.5
90 0.49
91 0.46
92 0.44
93 0.44
94 0.5
95 0.51
96 0.51
97 0.51
98 0.56
99 0.56
100 0.61
101 0.58
102 0.56
103 0.54
104 0.57
105 0.61
106 0.6
107 0.65
108 0.66
109 0.64
110 0.6
111 0.64
112 0.56
113 0.51
114 0.47
115 0.42
116 0.36
117 0.33
118 0.31
119 0.29
120 0.33
121 0.38
122 0.42
123 0.45
124 0.48
125 0.56
126 0.65
127 0.68
128 0.71
129 0.71
130 0.72
131 0.76
132 0.79
133 0.72
134 0.66
135 0.63
136 0.56
137 0.49
138 0.4
139 0.35
140 0.28
141 0.29
142 0.27
143 0.23
144 0.2
145 0.18
146 0.18
147 0.13
148 0.13
149 0.11
150 0.1
151 0.09
152 0.1
153 0.09
154 0.11
155 0.11
156 0.09
157 0.11
158 0.12
159 0.12
160 0.12
161 0.13
162 0.12
163 0.12
164 0.15
165 0.13
166 0.19
167 0.23
168 0.27
169 0.31
170 0.33
171 0.37
172 0.36
173 0.4
174 0.39
175 0.39
176 0.38
177 0.35
178 0.34
179 0.34
180 0.4
181 0.39
182 0.36
183 0.42
184 0.47
185 0.54
186 0.63
187 0.69
188 0.72
189 0.76
190 0.81
191 0.8
192 0.8
193 0.71
194 0.61
195 0.5
196 0.39
197 0.31
198 0.23
199 0.15
200 0.07
201 0.06
202 0.07
203 0.08
204 0.1
205 0.11
206 0.11
207 0.12
208 0.13
209 0.13
210 0.12
211 0.14
212 0.12