Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JXE8

Protein Details
Accession B6JXE8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
190-215AANKTNKHLPQPRKARQQQPSKPIIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0005634  C:nucleus  
GO:0035861  C:site of double-strand break  
GO:0000405  F:bubble DNA binding  
GO:0106260  F:DNA-DNA tethering activity  
GO:0000406  F:double-strand/single-strand DNA junction binding  
GO:0140656  F:endodeoxyribonuclease activator activity  
GO:0004519  F:endonuclease activity  
GO:0070336  F:flap-structured DNA binding  
GO:0042802  F:identical protein binding  
GO:0003697  F:single-stranded DNA binding  
GO:0000403  F:Y-form DNA binding  
GO:1990918  P:double-strand break repair involved in meiotic recombination  
GO:0000724  P:double-strand break repair via homologous recombination  
GO:0006303  P:double-strand break repair via nonhomologous end joining  
GO:0007534  P:gene conversion at mating-type locus  
GO:0000706  P:meiotic DNA double-strand break processing  
GO:0033314  P:mitotic DNA replication checkpoint signaling  
GO:1990426  P:mitotic recombination-dependent replication fork processing  
GO:0120290  P:stalled replication fork localization to nuclear periphery  
Amino Acid Sequences MKPNSFDWKQLCAQFGDYVESLHREISSLKTALAFETELRKSLEEEINKAKAERRLTGADTKSNAAEDTEEEDVSTTEEEEEEDENDKADNIPLSRVASSVSSGSVARISAKTMPNSDDSETSMDENAPLSSIHRTATPITPRQTSKTVDNSVLASDSDSDSEGEKKLQARSLEEMILLRETQIPLTPVAANKTNKHLPQPRKARQQQPSKPIIEDDDGTTIRGHKRKTLPAFDCPDCEKFTITRACQIAFWSAEME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.29
4 0.24
5 0.21
6 0.2
7 0.21
8 0.19
9 0.17
10 0.16
11 0.12
12 0.14
13 0.17
14 0.21
15 0.19
16 0.19
17 0.19
18 0.2
19 0.19
20 0.19
21 0.16
22 0.13
23 0.19
24 0.2
25 0.2
26 0.21
27 0.21
28 0.21
29 0.26
30 0.31
31 0.26
32 0.3
33 0.35
34 0.37
35 0.37
36 0.37
37 0.36
38 0.35
39 0.37
40 0.35
41 0.33
42 0.33
43 0.36
44 0.43
45 0.41
46 0.4
47 0.38
48 0.36
49 0.32
50 0.28
51 0.25
52 0.17
53 0.15
54 0.11
55 0.13
56 0.13
57 0.12
58 0.11
59 0.11
60 0.11
61 0.11
62 0.1
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.07
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.07
79 0.08
80 0.1
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.08
95 0.07
96 0.09
97 0.13
98 0.15
99 0.16
100 0.17
101 0.19
102 0.2
103 0.22
104 0.22
105 0.17
106 0.16
107 0.16
108 0.15
109 0.14
110 0.12
111 0.09
112 0.08
113 0.08
114 0.07
115 0.06
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.09
123 0.1
124 0.15
125 0.19
126 0.23
127 0.25
128 0.29
129 0.3
130 0.32
131 0.34
132 0.32
133 0.32
134 0.34
135 0.34
136 0.31
137 0.3
138 0.27
139 0.24
140 0.22
141 0.16
142 0.1
143 0.08
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.09
150 0.09
151 0.09
152 0.11
153 0.14
154 0.15
155 0.19
156 0.19
157 0.21
158 0.24
159 0.25
160 0.23
161 0.21
162 0.2
163 0.16
164 0.16
165 0.13
166 0.1
167 0.1
168 0.1
169 0.1
170 0.1
171 0.11
172 0.1
173 0.12
174 0.13
175 0.12
176 0.15
177 0.22
178 0.24
179 0.25
180 0.32
181 0.37
182 0.37
183 0.46
184 0.52
185 0.53
186 0.6
187 0.69
188 0.72
189 0.76
190 0.84
191 0.84
192 0.84
193 0.87
194 0.86
195 0.84
196 0.82
197 0.74
198 0.66
199 0.58
200 0.52
201 0.44
202 0.36
203 0.29
204 0.26
205 0.23
206 0.23
207 0.22
208 0.22
209 0.26
210 0.3
211 0.3
212 0.34
213 0.41
214 0.5
215 0.58
216 0.65
217 0.62
218 0.66
219 0.72
220 0.66
221 0.63
222 0.57
223 0.52
224 0.44
225 0.41
226 0.34
227 0.28
228 0.33
229 0.37
230 0.35
231 0.39
232 0.38
233 0.38
234 0.36
235 0.38
236 0.36
237 0.28