Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JVS9

Protein Details
Accession B6JVS9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-100QPSNIRRKRKHGFLSRIRTHLGRRILNRRKRKGRRYLSHBasic
NLS Segment(s)
PositionSequence
67-96RRKRKHGFLSRIRTHLGRRILNRRKRKGRR
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNVLQSSFRLIGLSNIQKCVSGKMISSFFSKASPFSQTQQTPSVSPFGWSQQRWKSYGMEYQPSNIRRKRKHGFLSRIRTHLGRRILNRRKRKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.29
4 0.31
5 0.31
6 0.31
7 0.27
8 0.2
9 0.19
10 0.22
11 0.23
12 0.23
13 0.25
14 0.23
15 0.19
16 0.2
17 0.19
18 0.16
19 0.16
20 0.18
21 0.18
22 0.2
23 0.26
24 0.26
25 0.28
26 0.31
27 0.3
28 0.26
29 0.25
30 0.25
31 0.17
32 0.18
33 0.15
34 0.16
35 0.2
36 0.2
37 0.25
38 0.28
39 0.31
40 0.31
41 0.32
42 0.3
43 0.27
44 0.32
45 0.29
46 0.28
47 0.26
48 0.27
49 0.32
50 0.34
51 0.39
52 0.39
53 0.45
54 0.47
55 0.56
56 0.61
57 0.64
58 0.71
59 0.74
60 0.79
61 0.8
62 0.84
63 0.8
64 0.76
65 0.69
66 0.62
67 0.55
68 0.53
69 0.51
70 0.47
71 0.5
72 0.58
73 0.66
74 0.73
75 0.79
76 0.83
77 0.86
78 0.9
79 0.92
80 0.92