Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K7C5

Protein Details
Accession B6K7C5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
252-275ASGTDERHRRDPPRRNMRLPGEPDBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 6.5, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045128  PI31-like  
IPR013886  PI31_Prot_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000502  C:proteasome complex  
GO:0004866  F:endopeptidase inhibitor activity  
GO:0070628  F:proteasome binding  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF08577  PI31_Prot_C  
Amino Acid Sequences MGDIETDFMKKFHNSALSLGAKFEYCELIDGTRLSELQKDAYSNETLCYSVHSHKLRFRLLQFDGWFFCLGSNLQLDRAASSVFDRKSFDDGLWDISDLFSRLTETGLNVESSTVTSSVRARSTTSAAPHANINDGERHTPSSTSPFSSGIRVGDDPSLRFGLPPGGTRSSRFPAIGSDDLNPAGTNAHTPSNDGGMFPTAAHPIFQGPIIGDPVLMGGERNPINGQFHPSPGLVRPPGARYDPTGPNDPFASGTDERHRRDPPRRNMRLPGEPDNDELMPPGADSMFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.35
4 0.36
5 0.35
6 0.35
7 0.3
8 0.24
9 0.23
10 0.22
11 0.16
12 0.11
13 0.13
14 0.13
15 0.13
16 0.14
17 0.14
18 0.14
19 0.13
20 0.14
21 0.13
22 0.15
23 0.16
24 0.17
25 0.18
26 0.18
27 0.18
28 0.21
29 0.22
30 0.19
31 0.19
32 0.17
33 0.16
34 0.14
35 0.17
36 0.17
37 0.19
38 0.27
39 0.31
40 0.35
41 0.39
42 0.46
43 0.48
44 0.49
45 0.48
46 0.47
47 0.45
48 0.48
49 0.45
50 0.41
51 0.37
52 0.33
53 0.31
54 0.23
55 0.2
56 0.14
57 0.13
58 0.11
59 0.12
60 0.11
61 0.12
62 0.13
63 0.13
64 0.12
65 0.12
66 0.11
67 0.08
68 0.1
69 0.16
70 0.15
71 0.17
72 0.18
73 0.19
74 0.23
75 0.23
76 0.21
77 0.18
78 0.18
79 0.2
80 0.18
81 0.17
82 0.13
83 0.12
84 0.13
85 0.1
86 0.09
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.06
102 0.06
103 0.07
104 0.09
105 0.11
106 0.12
107 0.13
108 0.13
109 0.15
110 0.18
111 0.19
112 0.19
113 0.22
114 0.21
115 0.21
116 0.21
117 0.19
118 0.18
119 0.15
120 0.15
121 0.12
122 0.13
123 0.13
124 0.13
125 0.15
126 0.13
127 0.14
128 0.13
129 0.16
130 0.16
131 0.16
132 0.16
133 0.16
134 0.16
135 0.17
136 0.17
137 0.12
138 0.13
139 0.12
140 0.12
141 0.13
142 0.13
143 0.12
144 0.13
145 0.13
146 0.11
147 0.11
148 0.1
149 0.12
150 0.12
151 0.14
152 0.16
153 0.19
154 0.2
155 0.22
156 0.26
157 0.24
158 0.25
159 0.23
160 0.19
161 0.17
162 0.22
163 0.22
164 0.19
165 0.18
166 0.17
167 0.17
168 0.17
169 0.14
170 0.09
171 0.08
172 0.07
173 0.07
174 0.07
175 0.1
176 0.1
177 0.12
178 0.12
179 0.14
180 0.14
181 0.13
182 0.12
183 0.11
184 0.11
185 0.1
186 0.1
187 0.09
188 0.09
189 0.09
190 0.09
191 0.09
192 0.09
193 0.09
194 0.08
195 0.07
196 0.08
197 0.09
198 0.09
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.05
205 0.04
206 0.1
207 0.1
208 0.11
209 0.12
210 0.14
211 0.17
212 0.19
213 0.25
214 0.21
215 0.22
216 0.24
217 0.23
218 0.24
219 0.22
220 0.28
221 0.22
222 0.24
223 0.25
224 0.25
225 0.29
226 0.3
227 0.29
228 0.27
229 0.33
230 0.38
231 0.39
232 0.44
233 0.4
234 0.4
235 0.39
236 0.35
237 0.3
238 0.24
239 0.27
240 0.21
241 0.25
242 0.32
243 0.39
244 0.42
245 0.47
246 0.53
247 0.55
248 0.64
249 0.7
250 0.72
251 0.76
252 0.81
253 0.82
254 0.85
255 0.84
256 0.83
257 0.79
258 0.77
259 0.72
260 0.65
261 0.61
262 0.55
263 0.47
264 0.37
265 0.32
266 0.23
267 0.17
268 0.15
269 0.13