Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3K3

Protein Details
Accession B6K3K3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-92QENETEKERKKQPRKRIPIKKLLSMDHydrophilic
NLS Segment(s)
PositionSequence
73-87KERKKQPRKRIPIKK
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR036394  Ribosomal_L22/L17_sf  
IPR005727  Ribosomal_L22_bac/chlpt-type  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0042255  P:ribosome assembly  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
CDD cd00336  Ribosomal_L22  
Amino Acid Sequences MSLLDFRRAVTILSPVGFFKSSLYNCYHTTVTCRNNNSVPEIVRGGPALLQHAASLRDQYSPPKALQENETEKERKKQPRKRIPIKKLLSMDPFHVHKSMMMHSSYKKVAPLCRQIARQPFYDALLQMQMSSKRVSKRIAHALVEAKENAIKESDLDPSTLYVSEAWVGRGPYSKKIWPLSRGRTAIRRSPRVHVTVVLKDKRALMRFVQYRLQRKDNKPVWQPLQDKPFYNKRNQFTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.19
4 0.19
5 0.17
6 0.15
7 0.21
8 0.21
9 0.24
10 0.28
11 0.29
12 0.3
13 0.34
14 0.33
15 0.25
16 0.31
17 0.36
18 0.39
19 0.43
20 0.45
21 0.46
22 0.49
23 0.5
24 0.48
25 0.44
26 0.38
27 0.34
28 0.33
29 0.29
30 0.25
31 0.23
32 0.19
33 0.15
34 0.14
35 0.13
36 0.11
37 0.1
38 0.1
39 0.12
40 0.13
41 0.12
42 0.14
43 0.12
44 0.14
45 0.15
46 0.19
47 0.23
48 0.24
49 0.24
50 0.28
51 0.29
52 0.29
53 0.31
54 0.35
55 0.36
56 0.37
57 0.42
58 0.39
59 0.4
60 0.45
61 0.51
62 0.53
63 0.58
64 0.64
65 0.7
66 0.78
67 0.87
68 0.9
69 0.92
70 0.91
71 0.9
72 0.85
73 0.81
74 0.74
75 0.68
76 0.61
77 0.51
78 0.45
79 0.39
80 0.36
81 0.3
82 0.27
83 0.22
84 0.18
85 0.19
86 0.18
87 0.16
88 0.15
89 0.16
90 0.17
91 0.2
92 0.2
93 0.19
94 0.19
95 0.19
96 0.23
97 0.27
98 0.34
99 0.35
100 0.38
101 0.4
102 0.42
103 0.48
104 0.45
105 0.4
106 0.34
107 0.29
108 0.27
109 0.26
110 0.21
111 0.13
112 0.12
113 0.1
114 0.08
115 0.1
116 0.09
117 0.1
118 0.11
119 0.14
120 0.16
121 0.2
122 0.24
123 0.26
124 0.32
125 0.4
126 0.42
127 0.39
128 0.39
129 0.41
130 0.38
131 0.35
132 0.29
133 0.2
134 0.18
135 0.17
136 0.14
137 0.1
138 0.09
139 0.09
140 0.1
141 0.13
142 0.12
143 0.13
144 0.12
145 0.12
146 0.13
147 0.11
148 0.1
149 0.07
150 0.07
151 0.08
152 0.08
153 0.09
154 0.1
155 0.1
156 0.11
157 0.17
158 0.18
159 0.22
160 0.26
161 0.29
162 0.33
163 0.4
164 0.45
165 0.47
166 0.54
167 0.56
168 0.6
169 0.61
170 0.6
171 0.6
172 0.6
173 0.61
174 0.61
175 0.62
176 0.57
177 0.6
178 0.62
179 0.58
180 0.54
181 0.51
182 0.47
183 0.47
184 0.53
185 0.5
186 0.45
187 0.43
188 0.46
189 0.47
190 0.44
191 0.39
192 0.33
193 0.39
194 0.43
195 0.45
196 0.48
197 0.49
198 0.56
199 0.6
200 0.66
201 0.66
202 0.68
203 0.75
204 0.75
205 0.77
206 0.75
207 0.78
208 0.76
209 0.75
210 0.74
211 0.71
212 0.73
213 0.68
214 0.64
215 0.61
216 0.65
217 0.61
218 0.67
219 0.68