Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3E9

Protein Details
Accession B6K3E9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40GKSLTKRQLPERPSRRKGRQAKRTTFVRSHydrophilic
NLS Segment(s)
PositionSequence
14-34SLTKRQLPERPSRRKGRQAKR
65-83KRARKLAKKRLGTLGRAKA
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAPGLIVGLNKGKSLTKRQLPERPSRRKGRQAKRTTFVRSIVREVAGFAPYERRLMELIRNSQDKRARKLAKKRLGTLGRAKAKIEELSSVIQSSRLAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.43
4 0.5
5 0.58
6 0.66
7 0.68
8 0.74
9 0.76
10 0.77
11 0.78
12 0.8
13 0.8
14 0.82
15 0.87
16 0.87
17 0.87
18 0.87
19 0.86
20 0.83
21 0.8
22 0.76
23 0.69
24 0.63
25 0.59
26 0.5
27 0.46
28 0.4
29 0.34
30 0.27
31 0.25
32 0.2
33 0.14
34 0.12
35 0.09
36 0.11
37 0.1
38 0.11
39 0.1
40 0.1
41 0.1
42 0.11
43 0.16
44 0.18
45 0.22
46 0.26
47 0.31
48 0.3
49 0.36
50 0.42
51 0.43
52 0.44
53 0.49
54 0.54
55 0.59
56 0.7
57 0.74
58 0.76
59 0.77
60 0.76
61 0.76
62 0.72
63 0.69
64 0.68
65 0.67
66 0.65
67 0.6
68 0.56
69 0.49
70 0.47
71 0.44
72 0.36
73 0.28
74 0.23
75 0.24
76 0.24
77 0.23
78 0.19
79 0.17