Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K303

Protein Details
Accession B6K303    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-35AYIFFTRWRRMKQKPLEPAPELHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, E.R. 5, golg 5, mito 3, cyto 2, vacu 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0012505  C:endomembrane system  
GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0008047  F:enzyme activator activity  
GO:0006696  P:ergosterol biosynthetic process  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MVSPQFVFIVTLAAYIFFTRWRRMKQKPLEPAPELEQPKWSLYTASELKRFNGKSSPFIFLAIKGDVYNVTEGGKFYGPGGPYYTFAGHDASRGLAKSSFEEDVVPEGDEMDDLSDLNEEEKSTLNDWKTFFDQKYPVVGRLVTPTEKEQHLAAEKAAPVENISEGIPAADSRSSTPSEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.12
5 0.16
6 0.23
7 0.3
8 0.38
9 0.47
10 0.56
11 0.66
12 0.71
13 0.78
14 0.81
15 0.83
16 0.82
17 0.75
18 0.69
19 0.64
20 0.61
21 0.55
22 0.45
23 0.4
24 0.34
25 0.33
26 0.31
27 0.26
28 0.19
29 0.16
30 0.23
31 0.25
32 0.28
33 0.32
34 0.31
35 0.32
36 0.39
37 0.39
38 0.34
39 0.36
40 0.33
41 0.35
42 0.37
43 0.39
44 0.31
45 0.33
46 0.3
47 0.24
48 0.24
49 0.18
50 0.15
51 0.11
52 0.11
53 0.09
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.07
60 0.09
61 0.08
62 0.08
63 0.08
64 0.1
65 0.1
66 0.1
67 0.13
68 0.12
69 0.13
70 0.14
71 0.14
72 0.11
73 0.12
74 0.13
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.08
84 0.09
85 0.11
86 0.11
87 0.1
88 0.11
89 0.1
90 0.1
91 0.11
92 0.09
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.1
111 0.14
112 0.15
113 0.18
114 0.2
115 0.22
116 0.26
117 0.29
118 0.28
119 0.29
120 0.31
121 0.29
122 0.36
123 0.35
124 0.32
125 0.29
126 0.28
127 0.24
128 0.26
129 0.28
130 0.21
131 0.22
132 0.23
133 0.26
134 0.26
135 0.26
136 0.22
137 0.23
138 0.26
139 0.24
140 0.22
141 0.22
142 0.21
143 0.22
144 0.23
145 0.17
146 0.14
147 0.15
148 0.14
149 0.11
150 0.11
151 0.09
152 0.08
153 0.08
154 0.08
155 0.07
156 0.09
157 0.09
158 0.1
159 0.12
160 0.15
161 0.19