Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BPV7

Protein Details
Accession A0A2H3BPV7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPQAGHydrophilic
NLS Segment(s)
PositionSequence
14-41KKAHRNGIKKPQAGRTRSLKGVDAKFRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPQAGRTRSLKGVDAKFRRNARFALVGSPGQNKKLQQRRDMLLSVLEIAAKHMSGGMTRAMGQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.82
5 0.81
6 0.81
7 0.85
8 0.83
9 0.79
10 0.74
11 0.74
12 0.72
13 0.66
14 0.63
15 0.59
16 0.55
17 0.54
18 0.5
19 0.45
20 0.43
21 0.45
22 0.48
23 0.46
24 0.45
25 0.48
26 0.52
27 0.5
28 0.46
29 0.41
30 0.35
31 0.34
32 0.3
33 0.26
34 0.22
35 0.21
36 0.2
37 0.25
38 0.23
39 0.21
40 0.23
41 0.23
42 0.3
43 0.38
44 0.43
45 0.44
46 0.5
47 0.51
48 0.54
49 0.53
50 0.44
51 0.36
52 0.3
53 0.24
54 0.18
55 0.15
56 0.1
57 0.1
58 0.1
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.1
65 0.1
66 0.1