Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BNU9

Protein Details
Accession A0A2H3BNU9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-41VCTLSASRRKDRRHYDKIRIPLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 13, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MKSLTKTSAKRLRLRCPAVCTLSASRRKDRRHYDKIRIPLASTVVDQLAKCYLKADDIDRNGTEYMRPLAWSYHYYCSTLKITKKDITDAHIFAVIPAGPEGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.71
4 0.7
5 0.65
6 0.58
7 0.53
8 0.48
9 0.5
10 0.52
11 0.51
12 0.53
13 0.57
14 0.63
15 0.68
16 0.73
17 0.74
18 0.76
19 0.8
20 0.82
21 0.81
22 0.82
23 0.76
24 0.66
25 0.57
26 0.47
27 0.4
28 0.31
29 0.23
30 0.16
31 0.12
32 0.13
33 0.11
34 0.1
35 0.12
36 0.11
37 0.1
38 0.11
39 0.1
40 0.1
41 0.11
42 0.14
43 0.16
44 0.17
45 0.2
46 0.19
47 0.21
48 0.2
49 0.19
50 0.16
51 0.13
52 0.13
53 0.1
54 0.11
55 0.1
56 0.11
57 0.13
58 0.16
59 0.18
60 0.22
61 0.23
62 0.24
63 0.24
64 0.27
65 0.29
66 0.32
67 0.34
68 0.34
69 0.39
70 0.42
71 0.43
72 0.45
73 0.42
74 0.42
75 0.42
76 0.37
77 0.33
78 0.3
79 0.28
80 0.22
81 0.22
82 0.17
83 0.12
84 0.12