Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3C2X6

Protein Details
Accession A0A2H3C2X6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-77PTYTILSTGKRRKKGRNSLSSHINVHydrophilic
NLS Segment(s)
PositionSequence
62-67KRRKKG
Subcellular Location(s) plas 7, E.R. 6, mito 4, extr 3, cyto_mito 3, cyto 2, pero 2, golg 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGEDAAVQTYSTLRLFRTLPLLVVMLFYFAAVWKVYNSCVVLCNFHMVLNYLPTYTILSTGKRRKKGRNSLSSHINV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.2
5 0.18
6 0.17
7 0.17
8 0.17
9 0.14
10 0.14
11 0.12
12 0.08
13 0.07
14 0.06
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.08
24 0.09
25 0.08
26 0.1
27 0.1
28 0.11
29 0.11
30 0.13
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.09
41 0.1
42 0.09
43 0.12
44 0.11
45 0.15
46 0.24
47 0.34
48 0.42
49 0.5
50 0.58
51 0.66
52 0.75
53 0.83
54 0.84
55 0.85
56 0.85
57 0.83