Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BAQ1

Protein Details
Accession A0A2H3BAQ1    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-114VCGPAPHQQLRRRNKANRDELLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.166, cyto 9, cyto_mito 7.499, cyto_pero 7.499, nucl 7, mito 4.5, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036316  Pili_assmbl_chap_C_dom_sf  
Amino Acid Sequences MWELTKAQESVGLPLSEWTIHRCIHYKPRLNAEHFKDDHATPLLLLLRQSGAWVNNPVPYYMSFLTHFRKGRNIVSTHKGSIVVIEGPVRGLVCGPAPHQQLRRRNKANRDELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.16
4 0.16
5 0.17
6 0.16
7 0.17
8 0.19
9 0.21
10 0.26
11 0.35
12 0.44
13 0.49
14 0.51
15 0.6
16 0.64
17 0.67
18 0.7
19 0.66
20 0.66
21 0.57
22 0.55
23 0.48
24 0.41
25 0.37
26 0.3
27 0.24
28 0.14
29 0.16
30 0.14
31 0.12
32 0.12
33 0.09
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.1
41 0.1
42 0.13
43 0.13
44 0.13
45 0.12
46 0.12
47 0.15
48 0.13
49 0.14
50 0.13
51 0.16
52 0.19
53 0.24
54 0.25
55 0.23
56 0.28
57 0.3
58 0.33
59 0.36
60 0.36
61 0.35
62 0.4
63 0.42
64 0.38
65 0.36
66 0.31
67 0.25
68 0.22
69 0.19
70 0.13
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.08
77 0.07
78 0.06
79 0.06
80 0.08
81 0.1
82 0.12
83 0.18
84 0.23
85 0.29
86 0.37
87 0.44
88 0.52
89 0.6
90 0.69
91 0.72
92 0.78
93 0.82
94 0.85