Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BB28

Protein Details
Accession A0A2H3BB28    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-38AKTYRWPGYQHRNHKRNRERIASQKSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRSGNEDLQYFAKTYRWPGYQHRNHKRNRERIASQKSIDESRRRINTSVRVQPKSAGQGDTTWSTVTTSSYNLRCAGSVSSMRGSIIWLGLDIAARYKKGKGVVTRRLAVYGGGEPRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.29
4 0.32
5 0.41
6 0.51
7 0.58
8 0.67
9 0.73
10 0.75
11 0.79
12 0.86
13 0.87
14 0.86
15 0.84
16 0.82
17 0.78
18 0.79
19 0.8
20 0.75
21 0.66
22 0.59
23 0.54
24 0.51
25 0.49
26 0.45
27 0.41
28 0.43
29 0.47
30 0.46
31 0.45
32 0.45
33 0.48
34 0.5
35 0.54
36 0.53
37 0.5
38 0.48
39 0.47
40 0.44
41 0.4
42 0.34
43 0.26
44 0.18
45 0.17
46 0.19
47 0.18
48 0.17
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.09
56 0.13
57 0.14
58 0.15
59 0.16
60 0.16
61 0.15
62 0.16
63 0.15
64 0.14
65 0.14
66 0.15
67 0.15
68 0.15
69 0.15
70 0.13
71 0.13
72 0.1
73 0.09
74 0.07
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.1
81 0.1
82 0.12
83 0.13
84 0.14
85 0.18
86 0.23
87 0.29
88 0.35
89 0.44
90 0.53
91 0.58
92 0.61
93 0.59
94 0.55
95 0.49
96 0.4
97 0.33
98 0.28
99 0.25