Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3B1Z0

Protein Details
Accession A0A2H3B1Z0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23RVTLRKRQPYNTTSNRRRVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTTSNRRRVVKTPGGKLVYHHIKKPATAPKCGDCGIALPGVPALRPRQYATISKRQKTVRRAYGGSRCGECVKSRILRAFLVEEAKIVKRVIKSQQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.8
5 0.8
6 0.76
7 0.74
8 0.69
9 0.68
10 0.67
11 0.66
12 0.63
13 0.63
14 0.6
15 0.56
16 0.52
17 0.52
18 0.52
19 0.46
20 0.43
21 0.42
22 0.4
23 0.4
24 0.46
25 0.46
26 0.39
27 0.41
28 0.41
29 0.38
30 0.4
31 0.39
32 0.32
33 0.23
34 0.21
35 0.17
36 0.14
37 0.1
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.15
48 0.18
49 0.26
50 0.31
51 0.39
52 0.45
53 0.46
54 0.51
55 0.55
56 0.6
57 0.61
58 0.65
59 0.63
60 0.61
61 0.61
62 0.62
63 0.64
64 0.61
65 0.55
66 0.47
67 0.4
68 0.36
69 0.36
70 0.3
71 0.24
72 0.27
73 0.28
74 0.31
75 0.34
76 0.35
77 0.34
78 0.35
79 0.35
80 0.3
81 0.29
82 0.24
83 0.2
84 0.21
85 0.22
86 0.21
87 0.19
88 0.21
89 0.21
90 0.28
91 0.37