Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K1H0

Protein Details
Accession B6K1H0    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-39GGSLKLKSKTKSRISKKLKKKKTKDRTKTTDAVKDBasic
NLS Segment(s)
PositionSequence
9-47KLKSKTKSRISKKLKKKKTKDRTKTTDAVKDKGSEKEKE
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MEFVGGSLKLKSKTKSRISKKLKKKKTKDRTKTTDAVKDKGSEKEKEKEKAVQDYVMVYANGGDEPSESQKTESERRLEETQRRRLLEKGEVKSYEEKMKEYNRLLGSQSEHFDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.7
4 0.76
5 0.82
6 0.88
7 0.9
8 0.91
9 0.92
10 0.92
11 0.93
12 0.94
13 0.94
14 0.95
15 0.95
16 0.94
17 0.92
18 0.89
19 0.85
20 0.8
21 0.78
22 0.71
23 0.63
24 0.53
25 0.48
26 0.43
27 0.43
28 0.41
29 0.37
30 0.38
31 0.43
32 0.48
33 0.48
34 0.49
35 0.47
36 0.46
37 0.47
38 0.44
39 0.36
40 0.3
41 0.26
42 0.24
43 0.19
44 0.15
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.04
51 0.03
52 0.05
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.17
59 0.22
60 0.25
61 0.26
62 0.27
63 0.32
64 0.36
65 0.4
66 0.45
67 0.49
68 0.54
69 0.56
70 0.57
71 0.54
72 0.52
73 0.5
74 0.51
75 0.51
76 0.46
77 0.46
78 0.45
79 0.46
80 0.47
81 0.46
82 0.44
83 0.36
84 0.34
85 0.34
86 0.39
87 0.43
88 0.41
89 0.45
90 0.4
91 0.41
92 0.41
93 0.39
94 0.37
95 0.34
96 0.34
97 0.29
98 0.27
99 0.25
100 0.25
101 0.23