Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K0J6

Protein Details
Accession B6K0J6   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
180-208RVVVTRPTRTAKNKKQNQNQNPKTQGKTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:1905267  P:endonucleolytic cleavage involved in tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MKKQGKKKEIVKLVLDNPLTAEWPETTTESKEKLCRLLLQGMGANVQDARTTGLTIGLNETNKLIEDCIQTGSDLPRVVFVTLPTDSILVSHFPQLIANGNAFSQTQAHESRPECRLVAIPNEMEAAFASRLGLSRVRAIAVASTSPILPSIAPILETVSPPSWPSSSEATGFLATKIDRVVVTRPTRTAKNKKQNQNQNPKTQGKTSAKVKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.57
3 0.47
4 0.39
5 0.33
6 0.28
7 0.21
8 0.18
9 0.11
10 0.13
11 0.15
12 0.15
13 0.17
14 0.19
15 0.23
16 0.24
17 0.28
18 0.31
19 0.32
20 0.34
21 0.35
22 0.35
23 0.35
24 0.38
25 0.34
26 0.32
27 0.31
28 0.27
29 0.25
30 0.21
31 0.17
32 0.11
33 0.1
34 0.08
35 0.07
36 0.09
37 0.08
38 0.08
39 0.08
40 0.11
41 0.11
42 0.12
43 0.14
44 0.15
45 0.15
46 0.15
47 0.15
48 0.12
49 0.12
50 0.12
51 0.09
52 0.1
53 0.11
54 0.11
55 0.12
56 0.12
57 0.12
58 0.13
59 0.14
60 0.13
61 0.12
62 0.11
63 0.12
64 0.12
65 0.12
66 0.11
67 0.1
68 0.11
69 0.11
70 0.12
71 0.1
72 0.09
73 0.09
74 0.08
75 0.09
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.06
92 0.06
93 0.09
94 0.1
95 0.11
96 0.15
97 0.16
98 0.19
99 0.21
100 0.21
101 0.18
102 0.17
103 0.18
104 0.16
105 0.18
106 0.16
107 0.14
108 0.13
109 0.14
110 0.13
111 0.11
112 0.1
113 0.09
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.08
120 0.1
121 0.09
122 0.11
123 0.11
124 0.12
125 0.12
126 0.11
127 0.11
128 0.1
129 0.09
130 0.07
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.05
137 0.06
138 0.07
139 0.07
140 0.07
141 0.07
142 0.09
143 0.09
144 0.1
145 0.12
146 0.11
147 0.11
148 0.12
149 0.14
150 0.12
151 0.13
152 0.15
153 0.17
154 0.19
155 0.2
156 0.2
157 0.2
158 0.21
159 0.2
160 0.17
161 0.15
162 0.13
163 0.13
164 0.12
165 0.12
166 0.1
167 0.12
168 0.16
169 0.22
170 0.28
171 0.3
172 0.34
173 0.38
174 0.46
175 0.55
176 0.62
177 0.64
178 0.7
179 0.77
180 0.83
181 0.89
182 0.92
183 0.93
184 0.93
185 0.91
186 0.9
187 0.89
188 0.86
189 0.8
190 0.74
191 0.73
192 0.69
193 0.69
194 0.69