Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BYJ1

Protein Details
Accession A0A2H3BYJ1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-68DGQRLRKTRPQECQPNKKKGDPSHydrophilic
NLS Segment(s)
PositionSequence
29-34KKGGRK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences TAEKSRPYKDANPKTGSGWSKNVQSIRTKKGGRKKEDDVNSEVHNDGQRLRKTRPQECQPNKKKGDPSSMEGSATKKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.56
4 0.49
5 0.45
6 0.4
7 0.39
8 0.42
9 0.42
10 0.38
11 0.42
12 0.44
13 0.44
14 0.49
15 0.49
16 0.51
17 0.58
18 0.64
19 0.62
20 0.62
21 0.62
22 0.63
23 0.65
24 0.62
25 0.55
26 0.48
27 0.41
28 0.36
29 0.3
30 0.23
31 0.17
32 0.14
33 0.15
34 0.2
35 0.24
36 0.27
37 0.31
38 0.36
39 0.43
40 0.51
41 0.57
42 0.59
43 0.66
44 0.72
45 0.8
46 0.83
47 0.85
48 0.83
49 0.81
50 0.79
51 0.74
52 0.74
53 0.68
54 0.65
55 0.62
56 0.58
57 0.52
58 0.46