Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JVA1

Protein Details
Accession B6JVA1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
104-132KSRLAQDRQRILRRKRQHAKRSREKYSLTHydrophilic
NLS Segment(s)
PositionSequence
86-92KIARKRL
105-126SRLAQDRQRILRRKRQHAKRSR
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MKRLFGWRLFESMAFIARRQSFVYPAFIQQRFYHLVEADLDETFIRGHGPGGQKINKTSIVCQLRHKPSGLIVRCQETRSREQNRKIARKRLAEKLDLLANGEKSRLAQDRQRILRRKRQHAKRSREKYSLTTDEDDGNKIPTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.24
4 0.24
5 0.25
6 0.24
7 0.25
8 0.24
9 0.25
10 0.3
11 0.25
12 0.3
13 0.36
14 0.35
15 0.36
16 0.33
17 0.35
18 0.34
19 0.33
20 0.3
21 0.22
22 0.22
23 0.2
24 0.21
25 0.17
26 0.13
27 0.12
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.09
36 0.13
37 0.16
38 0.22
39 0.26
40 0.27
41 0.28
42 0.3
43 0.3
44 0.28
45 0.26
46 0.29
47 0.31
48 0.31
49 0.35
50 0.41
51 0.42
52 0.43
53 0.42
54 0.34
55 0.33
56 0.41
57 0.37
58 0.32
59 0.28
60 0.3
61 0.31
62 0.32
63 0.3
64 0.25
65 0.3
66 0.35
67 0.43
68 0.47
69 0.52
70 0.59
71 0.65
72 0.72
73 0.72
74 0.73
75 0.71
76 0.73
77 0.71
78 0.73
79 0.68
80 0.6
81 0.54
82 0.47
83 0.43
84 0.33
85 0.3
86 0.23
87 0.2
88 0.18
89 0.16
90 0.14
91 0.11
92 0.16
93 0.18
94 0.2
95 0.23
96 0.31
97 0.41
98 0.5
99 0.58
100 0.64
101 0.68
102 0.75
103 0.79
104 0.82
105 0.84
106 0.86
107 0.88
108 0.88
109 0.91
110 0.92
111 0.92
112 0.89
113 0.86
114 0.8
115 0.75
116 0.74
117 0.69
118 0.63
119 0.57
120 0.5
121 0.47
122 0.44
123 0.41
124 0.32