Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3AZ26

Protein Details
Accession A0A2H3AZ26   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-138PEKVPVKVKSTPRKKKNEPKKTPSVPTHydrophilic
NLS Segment(s)
PositionSequence
118-132KVKSTPRKKKNEPKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASLDGVEVNPIDEGSHDYDLPVPLVPRSFADDSPPTRPSSPLTVGEEDITSIAHPAVDDRDPLPDIGNASGDDIPFAAKNLRRSSRHTASTADLPADLVDDNTSVQKDTSPEKVPVKVKSTPRKKKNEPKKTPSVPTTAATTMSFLPSLPEHAKTYIKDLQFRVPLETYHPDDDVRFHNEAQARETRNRANAHIVRSALHYSEYRSFRDETGAHLHALMDKIEALPIGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.15
4 0.14
5 0.15
6 0.17
7 0.18
8 0.18
9 0.16
10 0.13
11 0.13
12 0.14
13 0.15
14 0.13
15 0.19
16 0.21
17 0.2
18 0.25
19 0.3
20 0.33
21 0.38
22 0.38
23 0.35
24 0.34
25 0.35
26 0.32
27 0.32
28 0.33
29 0.32
30 0.35
31 0.34
32 0.34
33 0.33
34 0.3
35 0.23
36 0.18
37 0.13
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.06
44 0.09
45 0.09
46 0.11
47 0.1
48 0.13
49 0.14
50 0.14
51 0.14
52 0.12
53 0.13
54 0.12
55 0.12
56 0.1
57 0.11
58 0.12
59 0.1
60 0.09
61 0.08
62 0.08
63 0.07
64 0.08
65 0.1
66 0.12
67 0.18
68 0.25
69 0.32
70 0.34
71 0.41
72 0.5
73 0.53
74 0.54
75 0.5
76 0.45
77 0.41
78 0.42
79 0.36
80 0.26
81 0.19
82 0.15
83 0.13
84 0.11
85 0.09
86 0.05
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.05
93 0.05
94 0.06
95 0.08
96 0.1
97 0.15
98 0.17
99 0.21
100 0.22
101 0.28
102 0.3
103 0.32
104 0.34
105 0.36
106 0.42
107 0.48
108 0.58
109 0.63
110 0.68
111 0.75
112 0.8
113 0.85
114 0.88
115 0.89
116 0.88
117 0.86
118 0.87
119 0.84
120 0.8
121 0.72
122 0.66
123 0.57
124 0.47
125 0.43
126 0.33
127 0.28
128 0.21
129 0.2
130 0.15
131 0.13
132 0.12
133 0.08
134 0.09
135 0.08
136 0.12
137 0.12
138 0.14
139 0.15
140 0.18
141 0.21
142 0.2
143 0.26
144 0.28
145 0.29
146 0.31
147 0.32
148 0.36
149 0.37
150 0.38
151 0.35
152 0.3
153 0.29
154 0.28
155 0.31
156 0.29
157 0.26
158 0.26
159 0.23
160 0.22
161 0.24
162 0.24
163 0.24
164 0.22
165 0.2
166 0.24
167 0.28
168 0.29
169 0.3
170 0.33
171 0.33
172 0.35
173 0.4
174 0.4
175 0.42
176 0.44
177 0.42
178 0.45
179 0.45
180 0.45
181 0.45
182 0.41
183 0.35
184 0.36
185 0.35
186 0.26
187 0.24
188 0.21
189 0.21
190 0.29
191 0.31
192 0.3
193 0.31
194 0.32
195 0.3
196 0.35
197 0.31
198 0.28
199 0.32
200 0.32
201 0.28
202 0.27
203 0.26
204 0.23
205 0.24
206 0.19
207 0.12
208 0.11
209 0.11
210 0.11