Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BEJ6

Protein Details
Accession A0A2H3BEJ6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
202-221KTPTRSWFIRRLRRLFPSRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011010  DNA_brk_join_enz  
IPR013762  Integrase-like_cat_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006310  P:DNA recombination  
Amino Acid Sequences LHHLPVLPTEDTLSYYVVYMCAHIKPDSVDSYLSGICNRLENFFPNIRTIRTSMLVSRTLKGCKRLRGSEVHRKLPLSRDDIRRAIATLRPSLDHDDKLFLTLLVTGFNGLLRLAELSMPDTKKLRNWRKITRRSTVEWVPLGYSFLLPAHKADVTFEGNRIIIPASDDASINPSPIFHNYLVSRDERFPVHPGLWVTSAGKTPTRSWFIRRLRRLFPSRRIAGQSMRAGGATALASDGVLPHLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.11
6 0.1
7 0.11
8 0.12
9 0.15
10 0.15
11 0.16
12 0.17
13 0.21
14 0.22
15 0.21
16 0.2
17 0.18
18 0.21
19 0.21
20 0.19
21 0.16
22 0.15
23 0.14
24 0.18
25 0.17
26 0.17
27 0.18
28 0.21
29 0.26
30 0.29
31 0.29
32 0.3
33 0.31
34 0.3
35 0.31
36 0.3
37 0.27
38 0.25
39 0.25
40 0.23
41 0.26
42 0.3
43 0.29
44 0.3
45 0.31
46 0.34
47 0.36
48 0.42
49 0.44
50 0.46
51 0.52
52 0.54
53 0.54
54 0.58
55 0.63
56 0.65
57 0.67
58 0.65
59 0.6
60 0.56
61 0.54
62 0.51
63 0.48
64 0.43
65 0.43
66 0.44
67 0.47
68 0.48
69 0.47
70 0.41
71 0.36
72 0.32
73 0.28
74 0.23
75 0.2
76 0.2
77 0.19
78 0.2
79 0.25
80 0.25
81 0.24
82 0.21
83 0.21
84 0.2
85 0.2
86 0.19
87 0.13
88 0.1
89 0.09
90 0.09
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.06
105 0.09
106 0.1
107 0.11
108 0.12
109 0.12
110 0.17
111 0.28
112 0.36
113 0.42
114 0.49
115 0.59
116 0.68
117 0.78
118 0.8
119 0.77
120 0.71
121 0.66
122 0.65
123 0.58
124 0.51
125 0.42
126 0.35
127 0.28
128 0.24
129 0.21
130 0.15
131 0.11
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.09
139 0.09
140 0.09
141 0.12
142 0.15
143 0.15
144 0.15
145 0.15
146 0.14
147 0.14
148 0.14
149 0.11
150 0.07
151 0.08
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.13
158 0.13
159 0.12
160 0.11
161 0.1
162 0.11
163 0.13
164 0.17
165 0.13
166 0.17
167 0.17
168 0.2
169 0.22
170 0.23
171 0.24
172 0.22
173 0.24
174 0.21
175 0.23
176 0.23
177 0.24
178 0.23
179 0.23
180 0.23
181 0.23
182 0.23
183 0.22
184 0.2
185 0.18
186 0.2
187 0.19
188 0.21
189 0.21
190 0.23
191 0.29
192 0.34
193 0.35
194 0.38
195 0.46
196 0.53
197 0.61
198 0.68
199 0.67
200 0.68
201 0.76
202 0.8
203 0.79
204 0.78
205 0.78
206 0.73
207 0.72
208 0.7
209 0.64
210 0.6
211 0.59
212 0.54
213 0.47
214 0.42
215 0.37
216 0.31
217 0.27
218 0.22
219 0.14
220 0.09
221 0.07
222 0.07
223 0.07
224 0.06
225 0.07
226 0.06