Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K0H3

Protein Details
Accession B6K0H3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTQKRRNNGRNKHGRGHNKFVRCBasic
88-112SREGRRIRTPPPRVRYNRDGKKINPBasic
NLS Segment(s)
PositionSequence
87-109RSREGRRIRTPPPRVRYNRDGKK
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTQKRRNNGRNKHGRGHNKFVRCINCSRCVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHSRVVRVRSREGRRIRTPPPRVRYNRDGKKINPAVAVKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.85
4 0.82
5 0.77
6 0.75
7 0.72
8 0.69
9 0.62
10 0.61
11 0.57
12 0.56
13 0.55
14 0.56
15 0.56
16 0.56
17 0.57
18 0.57
19 0.62
20 0.6
21 0.64
22 0.64
23 0.66
24 0.63
25 0.68
26 0.66
27 0.64
28 0.59
29 0.52
30 0.48
31 0.4
32 0.38
33 0.3
34 0.25
35 0.17
36 0.16
37 0.12
38 0.11
39 0.1
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.08
52 0.08
53 0.09
54 0.12
55 0.17
56 0.19
57 0.21
58 0.24
59 0.25
60 0.25
61 0.27
62 0.25
63 0.19
64 0.2
65 0.2
66 0.23
67 0.22
68 0.25
69 0.28
70 0.33
71 0.36
72 0.38
73 0.44
74 0.48
75 0.55
76 0.6
77 0.63
78 0.66
79 0.7
80 0.73
81 0.74
82 0.75
83 0.78
84 0.79
85 0.78
86 0.8
87 0.79
88 0.81
89 0.82
90 0.82
91 0.82
92 0.81
93 0.8
94 0.72
95 0.76
96 0.73
97 0.67
98 0.63
99 0.55