Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BED7

Protein Details
Accession A0A2H3BED7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25IMNLIRTVRPRRRRLLLKGRFVNGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MIMNLIRTVRPRRRRLLLKGRFVNGSDGQFRRVLSGLLALRSLFHAFYSHAYLLCCWTLPFLCDLLCYTNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.82
5 0.82
6 0.8
7 0.75
8 0.66
9 0.58
10 0.53
11 0.44
12 0.37
13 0.33
14 0.27
15 0.27
16 0.26
17 0.25
18 0.21
19 0.18
20 0.15
21 0.1
22 0.13
23 0.12
24 0.11
25 0.11
26 0.1
27 0.09
28 0.11
29 0.11
30 0.07
31 0.07
32 0.07
33 0.08
34 0.1
35 0.14
36 0.13
37 0.14
38 0.14
39 0.14
40 0.16
41 0.15
42 0.14
43 0.1
44 0.11
45 0.11
46 0.12
47 0.13
48 0.12
49 0.11
50 0.12
51 0.14