Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BFR1

Protein Details
Accession A0A2H3BFR1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41KMAQTSKPKLPSERKKPGPKPWATEPHydrophilic
NLS Segment(s)
PositionSequence
22-35KPKLPSERKKPGPK
Subcellular Location(s) nucl 12, cyto 8.5, cyto_mito 7.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVGVEGGPNLSKKFEKMAQTSKPKLPSERKKPGPKPWATEPQECRLMEGVPGYRQAQAKKPKRNAISKFLDDFMPTWWAEFPLREGVTAAADRASANGSRITVPQKKIAGGVSVRDIFPRNSRALKAEELYSRKYYQTRVKPLVEDKKEEGSTQGQILNLVKAMTKEVFAQESEEIREEILIELKNQLPIKPTVGEEMTPEMFAAALKSAPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.41
4 0.49
5 0.55
6 0.63
7 0.68
8 0.69
9 0.7
10 0.67
11 0.69
12 0.71
13 0.72
14 0.73
15 0.77
16 0.81
17 0.85
18 0.89
19 0.9
20 0.89
21 0.85
22 0.81
23 0.79
24 0.8
25 0.75
26 0.75
27 0.69
28 0.65
29 0.65
30 0.58
31 0.51
32 0.42
33 0.36
34 0.28
35 0.27
36 0.23
37 0.17
38 0.19
39 0.18
40 0.21
41 0.24
42 0.26
43 0.31
44 0.39
45 0.47
46 0.55
47 0.62
48 0.67
49 0.71
50 0.78
51 0.76
52 0.74
53 0.72
54 0.66
55 0.6
56 0.53
57 0.45
58 0.36
59 0.31
60 0.23
61 0.18
62 0.13
63 0.12
64 0.11
65 0.12
66 0.12
67 0.11
68 0.12
69 0.14
70 0.14
71 0.14
72 0.14
73 0.13
74 0.14
75 0.13
76 0.11
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.08
86 0.08
87 0.1
88 0.16
89 0.2
90 0.22
91 0.25
92 0.25
93 0.25
94 0.25
95 0.24
96 0.21
97 0.16
98 0.15
99 0.14
100 0.14
101 0.14
102 0.14
103 0.15
104 0.13
105 0.16
106 0.18
107 0.18
108 0.19
109 0.21
110 0.22
111 0.24
112 0.25
113 0.23
114 0.23
115 0.25
116 0.26
117 0.28
118 0.29
119 0.27
120 0.27
121 0.28
122 0.31
123 0.35
124 0.41
125 0.47
126 0.5
127 0.51
128 0.52
129 0.59
130 0.63
131 0.57
132 0.53
133 0.46
134 0.47
135 0.45
136 0.41
137 0.35
138 0.28
139 0.26
140 0.23
141 0.22
142 0.15
143 0.17
144 0.17
145 0.15
146 0.13
147 0.12
148 0.1
149 0.09
150 0.12
151 0.1
152 0.11
153 0.11
154 0.13
155 0.14
156 0.14
157 0.16
158 0.15
159 0.16
160 0.18
161 0.18
162 0.16
163 0.14
164 0.14
165 0.12
166 0.11
167 0.13
168 0.12
169 0.11
170 0.14
171 0.15
172 0.21
173 0.22
174 0.22
175 0.22
176 0.24
177 0.26
178 0.26
179 0.25
180 0.25
181 0.25
182 0.25
183 0.23
184 0.26
185 0.24
186 0.21
187 0.2
188 0.15
189 0.13
190 0.13
191 0.11
192 0.07