Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CAD1

Protein Details
Accession A0A2H3CAD1   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-40AFVNRVVRRKQRPSRPPEISHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR001245  Ser-Thr/Tyr_kinase_cat_dom  
Gene Ontology GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF07714  PK_Tyr_Ser-Thr  
Amino Acid Sequences MLICQLYTGLPPLPKIPNDLAFVNRVVRRKQRPSRPPEISDELWAVVTRCWSHEPGDRPTMESLNSDIKKIIRGKSVAVSIRSREVASES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.3
5 0.32
6 0.32
7 0.3
8 0.27
9 0.28
10 0.29
11 0.28
12 0.28
13 0.3
14 0.38
15 0.45
16 0.54
17 0.62
18 0.67
19 0.73
20 0.78
21 0.82
22 0.8
23 0.74
24 0.7
25 0.66
26 0.56
27 0.48
28 0.4
29 0.3
30 0.23
31 0.2
32 0.14
33 0.08
34 0.08
35 0.07
36 0.08
37 0.09
38 0.1
39 0.13
40 0.19
41 0.23
42 0.27
43 0.32
44 0.3
45 0.3
46 0.31
47 0.29
48 0.25
49 0.21
50 0.19
51 0.23
52 0.23
53 0.22
54 0.22
55 0.22
56 0.27
57 0.31
58 0.33
59 0.3
60 0.31
61 0.33
62 0.36
63 0.42
64 0.4
65 0.4
66 0.4
67 0.36
68 0.4
69 0.39
70 0.34