Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3ARS0

Protein Details
Accession A0A2H3ARS0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
195-220DSDESVGRRRHRSRRKQRMSLLTGQYHydrophilic
NLS Segment(s)
PositionSequence
202-211RRRHRSRRKQ
Subcellular Location(s) nucl 11.5, cyto_nucl 9, cyto 5.5, plas 3, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MEPSRGLNLRLFARLLSGCLVNAVSPYTQLEDALEDIFLCVLLRMADSFAPLDTPSIDQRQRVFQSTALPSALAPVLVGEDNPPFEGAFEFPGTGTREEEKGSQTAPFKVILEVFQPSLPVWRRLSFGRQTRLLKSHDARTDQYLRKKNKEHLGFGKESDTQDKLDERLAQYTRFVYKLQESDTASSSSDDESWDSDESVGRRRHRSRRKQRMSLLTGQYFDVAHNQTSRRKFFQSRVVFDDTWQRVKLVQELRLGFGVSDLAGLMERGGGDGEDDWIEMDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.17
5 0.14
6 0.15
7 0.15
8 0.11
9 0.11
10 0.11
11 0.09
12 0.09
13 0.11
14 0.13
15 0.12
16 0.12
17 0.12
18 0.12
19 0.13
20 0.12
21 0.11
22 0.08
23 0.08
24 0.07
25 0.07
26 0.05
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.07
33 0.07
34 0.08
35 0.09
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.11
42 0.13
43 0.2
44 0.22
45 0.24
46 0.27
47 0.34
48 0.36
49 0.39
50 0.37
51 0.31
52 0.37
53 0.36
54 0.36
55 0.28
56 0.25
57 0.2
58 0.2
59 0.18
60 0.11
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.07
72 0.07
73 0.08
74 0.07
75 0.09
76 0.08
77 0.08
78 0.08
79 0.11
80 0.13
81 0.13
82 0.14
83 0.14
84 0.14
85 0.16
86 0.17
87 0.16
88 0.15
89 0.15
90 0.16
91 0.17
92 0.17
93 0.17
94 0.17
95 0.15
96 0.15
97 0.15
98 0.12
99 0.11
100 0.11
101 0.11
102 0.1
103 0.09
104 0.09
105 0.14
106 0.15
107 0.18
108 0.19
109 0.2
110 0.22
111 0.23
112 0.29
113 0.3
114 0.35
115 0.36
116 0.41
117 0.42
118 0.44
119 0.47
120 0.43
121 0.42
122 0.38
123 0.39
124 0.37
125 0.37
126 0.35
127 0.35
128 0.41
129 0.4
130 0.46
131 0.47
132 0.48
133 0.52
134 0.56
135 0.58
136 0.59
137 0.59
138 0.56
139 0.56
140 0.56
141 0.5
142 0.46
143 0.42
144 0.35
145 0.31
146 0.28
147 0.21
148 0.16
149 0.16
150 0.17
151 0.15
152 0.15
153 0.17
154 0.15
155 0.2
156 0.2
157 0.19
158 0.19
159 0.21
160 0.2
161 0.19
162 0.18
163 0.15
164 0.18
165 0.19
166 0.21
167 0.23
168 0.23
169 0.23
170 0.25
171 0.23
172 0.2
173 0.18
174 0.16
175 0.13
176 0.11
177 0.1
178 0.09
179 0.09
180 0.1
181 0.1
182 0.1
183 0.1
184 0.12
185 0.13
186 0.2
187 0.25
188 0.28
189 0.36
190 0.45
191 0.55
192 0.64
193 0.74
194 0.78
195 0.84
196 0.9
197 0.9
198 0.91
199 0.9
200 0.86
201 0.84
202 0.8
203 0.71
204 0.61
205 0.52
206 0.43
207 0.33
208 0.27
209 0.23
210 0.17
211 0.16
212 0.19
213 0.22
214 0.29
215 0.36
216 0.41
217 0.4
218 0.46
219 0.5
220 0.53
221 0.6
222 0.62
223 0.6
224 0.61
225 0.63
226 0.56
227 0.51
228 0.55
229 0.49
230 0.44
231 0.39
232 0.34
233 0.29
234 0.31
235 0.38
236 0.34
237 0.35
238 0.37
239 0.38
240 0.39
241 0.38
242 0.36
243 0.28
244 0.22
245 0.17
246 0.1
247 0.09
248 0.06
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.06
257 0.05
258 0.06
259 0.07
260 0.08
261 0.08
262 0.08