Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K517

Protein Details
Accession B6K517    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-34EQNRKWQSTLRKEQRALDRQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0000815  C:ESCRT III complex  
GO:0005771  C:multivesicular body  
GO:0031965  C:nuclear membrane  
GO:0042802  F:identical protein binding  
GO:1904669  P:ATP export  
GO:0032509  P:endosome transport via multivesicular body sorting pathway  
GO:0070676  P:intralumenal vesicle formation  
GO:0045324  P:late endosome to vacuole transport  
GO:0015031  P:protein transport  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences METIKSFFFKPSLQEQNRKWQSTLRKEQRALDRQNYALKTSKDKAERQIKLLARKNDVHNVRVLAKEVVRLKRHQRRLAESKALLNSLGLQLNEQMANIKIQGAMQSSSKIMHSVSSLSRLPQLSSLMQSLSMEMTKAGVLEEMVDDVLSPAADEEDLLDEIDEEDEEVRQIIAQYMPEAVKSATPSVSVTPQQVSAPEPILDLPSIPKPVEEPVAKDELQESDILDIRGRLDALKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.66
4 0.73
5 0.71
6 0.63
7 0.6
8 0.62
9 0.64
10 0.71
11 0.7
12 0.71
13 0.71
14 0.77
15 0.8
16 0.79
17 0.76
18 0.72
19 0.67
20 0.61
21 0.65
22 0.58
23 0.51
24 0.48
25 0.43
26 0.43
27 0.42
28 0.46
29 0.46
30 0.49
31 0.55
32 0.59
33 0.59
34 0.56
35 0.6
36 0.58
37 0.61
38 0.64
39 0.6
40 0.55
41 0.57
42 0.58
43 0.59
44 0.57
45 0.48
46 0.43
47 0.4
48 0.37
49 0.33
50 0.3
51 0.23
52 0.21
53 0.25
54 0.28
55 0.33
56 0.33
57 0.38
58 0.47
59 0.54
60 0.63
61 0.65
62 0.64
63 0.66
64 0.71
65 0.73
66 0.7
67 0.61
68 0.56
69 0.51
70 0.44
71 0.35
72 0.27
73 0.2
74 0.15
75 0.14
76 0.1
77 0.09
78 0.09
79 0.1
80 0.1
81 0.09
82 0.08
83 0.06
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.1
96 0.1
97 0.09
98 0.08
99 0.07
100 0.07
101 0.09
102 0.09
103 0.12
104 0.12
105 0.12
106 0.15
107 0.14
108 0.14
109 0.13
110 0.15
111 0.12
112 0.13
113 0.13
114 0.1
115 0.1
116 0.09
117 0.08
118 0.07
119 0.06
120 0.05
121 0.04
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.06
160 0.07
161 0.07
162 0.07
163 0.09
164 0.1
165 0.09
166 0.1
167 0.09
168 0.1
169 0.12
170 0.13
171 0.11
172 0.12
173 0.13
174 0.14
175 0.18
176 0.18
177 0.18
178 0.18
179 0.19
180 0.19
181 0.19
182 0.19
183 0.17
184 0.17
185 0.15
186 0.15
187 0.14
188 0.15
189 0.14
190 0.12
191 0.13
192 0.14
193 0.17
194 0.16
195 0.16
196 0.16
197 0.19
198 0.26
199 0.25
200 0.25
201 0.27
202 0.32
203 0.32
204 0.31
205 0.3
206 0.24
207 0.23
208 0.2
209 0.16
210 0.14
211 0.17
212 0.17
213 0.16
214 0.14
215 0.14
216 0.16
217 0.15