Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BUK9

Protein Details
Accession A0A2H3BUK9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-44FFPFKIYIRKCQKKAKPNDDPSVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 9, E.R. 2, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSISIPCTPRFSTVERQKGCFFPFKIYIRKCQKKAKPNDDPSVTSIIILMVYASFSVLAIRHTTHYGMLLGIPRGPGCKMKAGSFKVGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.57
4 0.55
5 0.56
6 0.54
7 0.51
8 0.42
9 0.37
10 0.42
11 0.43
12 0.49
13 0.48
14 0.55
15 0.58
16 0.66
17 0.67
18 0.7
19 0.73
20 0.74
21 0.82
22 0.82
23 0.82
24 0.8
25 0.81
26 0.74
27 0.67
28 0.59
29 0.52
30 0.41
31 0.3
32 0.23
33 0.15
34 0.11
35 0.09
36 0.07
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.03
44 0.04
45 0.05
46 0.06
47 0.07
48 0.09
49 0.1
50 0.11
51 0.11
52 0.12
53 0.11
54 0.1
55 0.11
56 0.12
57 0.11
58 0.11
59 0.12
60 0.11
61 0.12
62 0.14
63 0.17
64 0.17
65 0.25
66 0.27
67 0.33
68 0.42
69 0.45
70 0.49