Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3AQR8

Protein Details
Accession A0A2H3AQR8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-54QIQNARGRKRPKNTFRSFSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MDFPLTFREVYSCGQPKSTNSFPAKLDFLRENRVQIQNARGRKRPKNTFRSFSHDIFAVPKIWAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.33
4 0.38
5 0.4
6 0.4
7 0.37
8 0.39
9 0.37
10 0.39
11 0.38
12 0.3
13 0.3
14 0.26
15 0.25
16 0.27
17 0.27
18 0.26
19 0.28
20 0.3
21 0.28
22 0.25
23 0.31
24 0.32
25 0.38
26 0.41
27 0.44
28 0.5
29 0.57
30 0.65
31 0.69
32 0.72
33 0.76
34 0.8
35 0.81
36 0.78
37 0.78
38 0.74
39 0.65
40 0.57
41 0.47
42 0.39
43 0.34
44 0.3
45 0.23