Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3C350

Protein Details
Accession A0A2H3C350   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-144PSQAPSKRRNQGQPKGKKGKSKBasic
173-193GEPPLPKKNLKRKRPTTQAATHydrophilic
NLS Segment(s)
PositionSequence
128-152SKRRNQGQPKGKKGKSKGKGKATAP
176-186PLPKKNLKRKR
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MGSHAVGMTPRSMRRWLQCGSQRRNAPPLPPVTGPGAFLGAHPLSPVHEEAPAPTTPPPPLPVEEPLSIVVEELPPPVEPMEVDEPPSPPRAYHPMTGAPLYSRSLVITSLAPPEPSPPVLEPSQAPSKRRNQGQPKGKKGKSKGKGKATAPVPESARSPTPPPLPQTSAAHGEPPLPKKNLKRKRPTTQAATSEAGPSTQTTSSCPTHACSATAKAALIPEVQLDVDSESAGPSVKKPRFSPEKVAKRKSSQPIVTAALEPAPHDSNRMFHGLPKQQFLAAELTQAQDPDVAGIPIDRHNSRVELENYHFEDLITAPDEFFDPVRYGHKNGTYGARSSHYAFYARAPDHYEKTCLPCSARMIECTWTNWFPGATCDQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.46
4 0.51
5 0.57
6 0.64
7 0.67
8 0.69
9 0.7
10 0.69
11 0.74
12 0.68
13 0.64
14 0.61
15 0.58
16 0.54
17 0.47
18 0.44
19 0.4
20 0.37
21 0.33
22 0.26
23 0.23
24 0.18
25 0.16
26 0.2
27 0.15
28 0.14
29 0.14
30 0.13
31 0.13
32 0.15
33 0.17
34 0.12
35 0.13
36 0.14
37 0.15
38 0.18
39 0.17
40 0.16
41 0.18
42 0.19
43 0.19
44 0.21
45 0.22
46 0.22
47 0.24
48 0.26
49 0.28
50 0.31
51 0.29
52 0.29
53 0.27
54 0.25
55 0.22
56 0.19
57 0.15
58 0.11
59 0.11
60 0.1
61 0.09
62 0.08
63 0.09
64 0.09
65 0.08
66 0.07
67 0.12
68 0.17
69 0.16
70 0.19
71 0.2
72 0.21
73 0.23
74 0.26
75 0.21
76 0.17
77 0.21
78 0.26
79 0.28
80 0.29
81 0.31
82 0.32
83 0.34
84 0.35
85 0.31
86 0.24
87 0.22
88 0.21
89 0.18
90 0.13
91 0.11
92 0.11
93 0.11
94 0.11
95 0.1
96 0.1
97 0.13
98 0.13
99 0.13
100 0.13
101 0.15
102 0.15
103 0.15
104 0.16
105 0.13
106 0.16
107 0.17
108 0.18
109 0.17
110 0.2
111 0.29
112 0.3
113 0.31
114 0.35
115 0.43
116 0.49
117 0.56
118 0.61
119 0.61
120 0.68
121 0.77
122 0.79
123 0.81
124 0.84
125 0.81
126 0.8
127 0.78
128 0.78
129 0.77
130 0.78
131 0.76
132 0.75
133 0.79
134 0.72
135 0.71
136 0.64
137 0.61
138 0.52
139 0.47
140 0.39
141 0.32
142 0.32
143 0.26
144 0.25
145 0.2
146 0.21
147 0.21
148 0.24
149 0.26
150 0.28
151 0.3
152 0.31
153 0.32
154 0.32
155 0.3
156 0.3
157 0.27
158 0.25
159 0.21
160 0.22
161 0.23
162 0.25
163 0.27
164 0.25
165 0.29
166 0.37
167 0.48
168 0.54
169 0.6
170 0.67
171 0.71
172 0.79
173 0.84
174 0.82
175 0.78
176 0.75
177 0.69
178 0.62
179 0.54
180 0.45
181 0.36
182 0.29
183 0.22
184 0.15
185 0.11
186 0.09
187 0.09
188 0.09
189 0.09
190 0.14
191 0.15
192 0.16
193 0.16
194 0.15
195 0.18
196 0.18
197 0.18
198 0.15
199 0.17
200 0.17
201 0.17
202 0.16
203 0.12
204 0.12
205 0.11
206 0.1
207 0.07
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.04
218 0.05
219 0.05
220 0.05
221 0.08
222 0.17
223 0.2
224 0.24
225 0.25
226 0.34
227 0.43
228 0.47
229 0.55
230 0.56
231 0.65
232 0.7
233 0.77
234 0.73
235 0.7
236 0.74
237 0.72
238 0.7
239 0.62
240 0.55
241 0.52
242 0.5
243 0.45
244 0.37
245 0.29
246 0.21
247 0.18
248 0.16
249 0.14
250 0.13
251 0.12
252 0.13
253 0.13
254 0.14
255 0.16
256 0.2
257 0.17
258 0.18
259 0.27
260 0.34
261 0.36
262 0.37
263 0.35
264 0.33
265 0.33
266 0.31
267 0.27
268 0.19
269 0.18
270 0.16
271 0.16
272 0.15
273 0.15
274 0.13
275 0.09
276 0.08
277 0.08
278 0.08
279 0.07
280 0.06
281 0.07
282 0.09
283 0.11
284 0.16
285 0.15
286 0.17
287 0.18
288 0.2
289 0.21
290 0.27
291 0.26
292 0.27
293 0.31
294 0.36
295 0.37
296 0.36
297 0.35
298 0.27
299 0.26
300 0.2
301 0.19
302 0.14
303 0.11
304 0.1
305 0.1
306 0.11
307 0.11
308 0.11
309 0.11
310 0.1
311 0.12
312 0.18
313 0.2
314 0.22
315 0.28
316 0.32
317 0.32
318 0.34
319 0.4
320 0.38
321 0.36
322 0.37
323 0.34
324 0.32
325 0.33
326 0.34
327 0.28
328 0.27
329 0.26
330 0.28
331 0.33
332 0.31
333 0.3
334 0.33
335 0.36
336 0.4
337 0.42
338 0.42
339 0.37
340 0.43
341 0.45
342 0.43
343 0.4
344 0.39
345 0.41
346 0.44
347 0.43
348 0.39
349 0.37
350 0.38
351 0.38
352 0.36
353 0.37
354 0.31
355 0.3
356 0.29
357 0.27
358 0.22
359 0.25