Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BB81

Protein Details
Accession A0A2H3BB81    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-68AGNVYKKTKTCRVKKKDCGTTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences TFSSTAPASSSIGMDERYRFRRIKAIEILNLPPESDRRSYYLKIFAGNVYKKTKTCRVKKKDCGTTSTPRWTLDLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.22
4 0.26
5 0.31
6 0.31
7 0.31
8 0.38
9 0.39
10 0.42
11 0.43
12 0.44
13 0.42
14 0.44
15 0.43
16 0.38
17 0.35
18 0.27
19 0.2
20 0.17
21 0.16
22 0.15
23 0.15
24 0.15
25 0.19
26 0.2
27 0.22
28 0.27
29 0.24
30 0.24
31 0.23
32 0.22
33 0.26
34 0.27
35 0.29
36 0.28
37 0.3
38 0.31
39 0.36
40 0.44
41 0.47
42 0.55
43 0.61
44 0.67
45 0.76
46 0.84
47 0.89
48 0.9
49 0.83
50 0.8
51 0.76
52 0.75
53 0.72
54 0.71
55 0.63
56 0.54
57 0.52