Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B561

Protein Details
Accession A0A2H3B561   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-93HSPSRKRKTLTRKKADTQSPKKKVRSTPAKPRASTHydrophilic
NLS Segment(s)
PositionSequence
59-107HSPSRKRKTLTRKKADTQSPKKKVRSTPAKPRASTSKAGSASPQKKGRK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MLITFHRTAQSTTIPGYVLYHWRPAPQLCIDPKLIDPGFLYGERDWSEEEEEEEQKPAHSPSRKRKTLTRKKADTQSPKKKVRSTPAKPRASTSKAGSASPQKKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.18
5 0.21
6 0.2
7 0.24
8 0.24
9 0.25
10 0.28
11 0.27
12 0.3
13 0.26
14 0.32
15 0.29
16 0.32
17 0.31
18 0.29
19 0.28
20 0.31
21 0.27
22 0.21
23 0.18
24 0.16
25 0.17
26 0.16
27 0.18
28 0.11
29 0.14
30 0.14
31 0.14
32 0.13
33 0.12
34 0.13
35 0.11
36 0.13
37 0.12
38 0.13
39 0.12
40 0.12
41 0.11
42 0.1
43 0.11
44 0.11
45 0.15
46 0.2
47 0.29
48 0.39
49 0.5
50 0.55
51 0.57
52 0.65
53 0.7
54 0.75
55 0.78
56 0.77
57 0.74
58 0.76
59 0.82
60 0.83
61 0.83
62 0.82
63 0.83
64 0.82
65 0.83
66 0.82
67 0.81
68 0.79
69 0.78
70 0.79
71 0.77
72 0.79
73 0.81
74 0.83
75 0.76
76 0.74
77 0.73
78 0.67
79 0.63
80 0.57
81 0.55
82 0.48
83 0.48
84 0.48
85 0.5
86 0.51
87 0.54