Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BF73

Protein Details
Accession A0A2H3BF73    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30AASYHCLPRRSKRLRLSQRHFERAKCHydrophilic
78-97ISPSPKGRSRHKVQTRDPYSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, mito 7, nucl 6, pero 2, cyto 1, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDIEAASYHCLPRRSKRLRLSQRHFERAKCVYAPLFPLVYISKLGERLMRGGNAALAMCIFVVLLLSVLSYRPDNLSISPSPKGRSRHKVQTRDPYSLTRRELQPRSGMARGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.68
4 0.75
5 0.81
6 0.87
7 0.86
8 0.86
9 0.87
10 0.87
11 0.81
12 0.71
13 0.68
14 0.6
15 0.56
16 0.45
17 0.39
18 0.3
19 0.29
20 0.29
21 0.23
22 0.2
23 0.15
24 0.16
25 0.14
26 0.14
27 0.13
28 0.11
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.13
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.09
41 0.08
42 0.06
43 0.04
44 0.04
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.04
57 0.05
58 0.05
59 0.06
60 0.08
61 0.09
62 0.1
63 0.14
64 0.16
65 0.19
66 0.22
67 0.23
68 0.25
69 0.3
70 0.36
71 0.41
72 0.48
73 0.53
74 0.61
75 0.69
76 0.76
77 0.79
78 0.83
79 0.8
80 0.76
81 0.71
82 0.68
83 0.64
84 0.61
85 0.57
86 0.52
87 0.54
88 0.58
89 0.6
90 0.56
91 0.57
92 0.55
93 0.57