Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K509

Protein Details
Accession B6K509   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-31MGTNTQTKQKKQQLNERYDSKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024738  Hfi1/Tada1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000124  C:SAGA complex  
GO:0003713  F:transcription coactivator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF12767  SAGA-Tad1  
Amino Acid Sequences MEANKVNSEMGTNTQTKQKKQQLNERYDSKRAQGVMSKQKQLLGDDFEMYTTMVTDFLIGQANRNELNKYLKKFLKNPKFVKLHNTLILEILKSLRNRTEKIKTDVVWVKRKKSDAFLLTHNRFVAFDNKQALTLKKIILSFNAKDRARIKAAIEDNRNITPLPSIPSESWVAKLPKIPVSQDKLNSVFVNDIKAGYVAPLSSETLELPDQDVLKTRITAIALENGLLGGIQKDVPAIILAGLESHLKNLFAKCLSIVNKNLRQTSEDEAPRIGIHDINLAWQVEPHALIEPFMHPRRLQCLVNKRNATDEAKIIEEVPVHSPSSSQSERWQVAKVLDEVLSVKMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.43
4 0.52
5 0.57
6 0.6
7 0.67
8 0.76
9 0.77
10 0.81
11 0.83
12 0.82
13 0.78
14 0.76
15 0.7
16 0.63
17 0.58
18 0.5
19 0.45
20 0.43
21 0.47
22 0.51
23 0.55
24 0.57
25 0.53
26 0.55
27 0.53
28 0.49
29 0.44
30 0.39
31 0.33
32 0.29
33 0.28
34 0.24
35 0.23
36 0.19
37 0.15
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.13
46 0.12
47 0.15
48 0.17
49 0.19
50 0.21
51 0.22
52 0.22
53 0.2
54 0.3
55 0.33
56 0.36
57 0.42
58 0.46
59 0.51
60 0.59
61 0.67
62 0.68
63 0.72
64 0.72
65 0.73
66 0.74
67 0.69
68 0.68
69 0.64
70 0.59
71 0.54
72 0.51
73 0.42
74 0.38
75 0.37
76 0.29
77 0.23
78 0.19
79 0.17
80 0.16
81 0.18
82 0.22
83 0.26
84 0.28
85 0.35
86 0.43
87 0.46
88 0.51
89 0.54
90 0.48
91 0.52
92 0.57
93 0.56
94 0.57
95 0.54
96 0.55
97 0.54
98 0.58
99 0.51
100 0.5
101 0.5
102 0.45
103 0.44
104 0.45
105 0.5
106 0.48
107 0.47
108 0.42
109 0.34
110 0.3
111 0.28
112 0.27
113 0.2
114 0.22
115 0.24
116 0.24
117 0.25
118 0.26
119 0.26
120 0.22
121 0.23
122 0.2
123 0.19
124 0.2
125 0.19
126 0.21
127 0.25
128 0.23
129 0.26
130 0.34
131 0.31
132 0.34
133 0.35
134 0.36
135 0.33
136 0.34
137 0.29
138 0.28
139 0.33
140 0.36
141 0.37
142 0.34
143 0.34
144 0.32
145 0.32
146 0.24
147 0.19
148 0.13
149 0.11
150 0.12
151 0.1
152 0.12
153 0.11
154 0.14
155 0.15
156 0.15
157 0.15
158 0.17
159 0.17
160 0.17
161 0.19
162 0.19
163 0.22
164 0.23
165 0.24
166 0.25
167 0.29
168 0.32
169 0.31
170 0.32
171 0.29
172 0.3
173 0.28
174 0.22
175 0.19
176 0.15
177 0.16
178 0.12
179 0.11
180 0.09
181 0.09
182 0.08
183 0.06
184 0.06
185 0.04
186 0.04
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.08
193 0.08
194 0.08
195 0.08
196 0.09
197 0.09
198 0.09
199 0.12
200 0.12
201 0.13
202 0.13
203 0.12
204 0.13
205 0.13
206 0.13
207 0.11
208 0.13
209 0.12
210 0.12
211 0.12
212 0.09
213 0.09
214 0.08
215 0.07
216 0.03
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.05
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.06
231 0.06
232 0.07
233 0.07
234 0.08
235 0.1
236 0.11
237 0.14
238 0.13
239 0.14
240 0.13
241 0.19
242 0.22
243 0.25
244 0.3
245 0.36
246 0.41
247 0.46
248 0.48
249 0.43
250 0.42
251 0.4
252 0.39
253 0.39
254 0.36
255 0.32
256 0.3
257 0.29
258 0.27
259 0.25
260 0.2
261 0.13
262 0.11
263 0.13
264 0.12
265 0.13
266 0.15
267 0.14
268 0.13
269 0.13
270 0.13
271 0.11
272 0.12
273 0.11
274 0.12
275 0.11
276 0.12
277 0.13
278 0.15
279 0.22
280 0.24
281 0.27
282 0.24
283 0.27
284 0.33
285 0.37
286 0.39
287 0.4
288 0.48
289 0.54
290 0.63
291 0.64
292 0.59
293 0.59
294 0.61
295 0.56
296 0.48
297 0.44
298 0.36
299 0.34
300 0.33
301 0.28
302 0.24
303 0.21
304 0.19
305 0.19
306 0.19
307 0.17
308 0.17
309 0.17
310 0.18
311 0.25
312 0.26
313 0.24
314 0.28
315 0.37
316 0.4
317 0.42
318 0.43
319 0.38
320 0.38
321 0.4
322 0.35
323 0.29
324 0.26
325 0.25
326 0.22