Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BYZ5

Protein Details
Accession A0A2H3BYZ5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-79QNQAPAKKAAPRKNRTQEETRHydrophilic
158-183TKFALECFKRRKKLKERFRKTCLKSGHydrophilic
NLS Segment(s)
PositionSequence
166-177KRRKKLKERFRK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015671  GSCR1_dom  
Pfam View protein in Pfam  
PF15249  GLTSCR1  
Amino Acid Sequences MSQAFSSPLSFTNTSIKPVQDAYPGVLSSSTQPLLPTAMSSSHAGPSTWRPPAHWNLAQNQAPAKKAAPRKNRTQEETRIAANVAAKVAARLAADQAAVIHPDVDTPFSDTLDVVKRLLPYHIYQQPPEDLHTLIHGNVGKGKGKATDDDLNREIHETKFALECFKRRKKLKERFRKTCLKSGRRSAPDDQAVFLAQAVLEGERADTVTLNNELRTARSELDRLEREKRVATNAQRTSYYMATQPVTPATTASRPYYHSYPYAYAQAYGAPVQQSSTSSFSVAPVTPAPTAPAPTAPYQIGSAIPVQLPVSSLPALHQLGIVPVAPTSVTDGQPAPPAVLRGSSANGTMLSLEINVSVLQSSQMSGLAVILNSLMSRSSSSGGSTAVTAMPVQGTGTTAGGATLGATGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.33
4 0.29
5 0.31
6 0.32
7 0.28
8 0.29
9 0.27
10 0.27
11 0.26
12 0.24
13 0.22
14 0.2
15 0.18
16 0.21
17 0.18
18 0.15
19 0.16
20 0.16
21 0.18
22 0.17
23 0.15
24 0.12
25 0.13
26 0.15
27 0.16
28 0.17
29 0.18
30 0.19
31 0.18
32 0.19
33 0.26
34 0.31
35 0.35
36 0.34
37 0.33
38 0.4
39 0.48
40 0.54
41 0.51
42 0.49
43 0.48
44 0.57
45 0.57
46 0.51
47 0.5
48 0.44
49 0.4
50 0.37
51 0.34
52 0.33
53 0.4
54 0.48
55 0.52
56 0.56
57 0.66
58 0.75
59 0.81
60 0.8
61 0.79
62 0.78
63 0.74
64 0.71
65 0.61
66 0.51
67 0.43
68 0.38
69 0.31
70 0.23
71 0.16
72 0.14
73 0.12
74 0.11
75 0.11
76 0.11
77 0.09
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.09
86 0.08
87 0.07
88 0.06
89 0.07
90 0.08
91 0.08
92 0.08
93 0.11
94 0.11
95 0.11
96 0.12
97 0.11
98 0.14
99 0.18
100 0.18
101 0.15
102 0.17
103 0.18
104 0.19
105 0.2
106 0.2
107 0.17
108 0.24
109 0.3
110 0.3
111 0.3
112 0.31
113 0.34
114 0.32
115 0.32
116 0.26
117 0.19
118 0.17
119 0.18
120 0.17
121 0.13
122 0.15
123 0.14
124 0.12
125 0.15
126 0.17
127 0.18
128 0.17
129 0.18
130 0.18
131 0.19
132 0.2
133 0.22
134 0.27
135 0.26
136 0.31
137 0.31
138 0.29
139 0.28
140 0.28
141 0.25
142 0.17
143 0.19
144 0.13
145 0.13
146 0.15
147 0.15
148 0.19
149 0.19
150 0.25
151 0.33
152 0.41
153 0.48
154 0.53
155 0.63
156 0.69
157 0.77
158 0.82
159 0.83
160 0.86
161 0.87
162 0.88
163 0.88
164 0.81
165 0.8
166 0.79
167 0.76
168 0.72
169 0.72
170 0.73
171 0.67
172 0.67
173 0.62
174 0.58
175 0.54
176 0.48
177 0.4
178 0.31
179 0.26
180 0.21
181 0.17
182 0.1
183 0.05
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.07
197 0.08
198 0.08
199 0.09
200 0.09
201 0.1
202 0.12
203 0.13
204 0.12
205 0.13
206 0.14
207 0.14
208 0.21
209 0.23
210 0.24
211 0.28
212 0.29
213 0.29
214 0.3
215 0.29
216 0.28
217 0.32
218 0.34
219 0.38
220 0.4
221 0.4
222 0.39
223 0.38
224 0.36
225 0.3
226 0.26
227 0.18
228 0.17
229 0.16
230 0.15
231 0.15
232 0.13
233 0.13
234 0.12
235 0.1
236 0.1
237 0.12
238 0.14
239 0.16
240 0.17
241 0.19
242 0.23
243 0.25
244 0.25
245 0.24
246 0.24
247 0.25
248 0.25
249 0.26
250 0.22
251 0.2
252 0.18
253 0.17
254 0.15
255 0.13
256 0.13
257 0.09
258 0.09
259 0.09
260 0.09
261 0.1
262 0.12
263 0.14
264 0.13
265 0.14
266 0.14
267 0.14
268 0.16
269 0.15
270 0.14
271 0.12
272 0.14
273 0.13
274 0.13
275 0.14
276 0.13
277 0.14
278 0.13
279 0.14
280 0.15
281 0.16
282 0.18
283 0.16
284 0.16
285 0.15
286 0.15
287 0.13
288 0.12
289 0.11
290 0.1
291 0.1
292 0.1
293 0.1
294 0.09
295 0.1
296 0.09
297 0.11
298 0.09
299 0.09
300 0.09
301 0.15
302 0.15
303 0.14
304 0.14
305 0.11
306 0.12
307 0.13
308 0.12
309 0.07
310 0.06
311 0.07
312 0.06
313 0.06
314 0.11
315 0.13
316 0.13
317 0.15
318 0.16
319 0.18
320 0.22
321 0.22
322 0.18
323 0.15
324 0.16
325 0.15
326 0.15
327 0.15
328 0.13
329 0.15
330 0.14
331 0.14
332 0.14
333 0.13
334 0.12
335 0.11
336 0.1
337 0.08
338 0.07
339 0.06
340 0.05
341 0.06
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.07
348 0.07
349 0.07
350 0.08
351 0.08
352 0.07
353 0.08
354 0.08
355 0.08
356 0.07
357 0.07
358 0.06
359 0.06
360 0.06
361 0.06
362 0.06
363 0.08
364 0.09
365 0.11
366 0.12
367 0.13
368 0.14
369 0.14
370 0.14
371 0.13
372 0.13
373 0.11
374 0.11
375 0.1
376 0.09
377 0.09
378 0.08
379 0.08
380 0.07
381 0.08
382 0.09
383 0.09
384 0.08
385 0.08
386 0.08
387 0.07
388 0.07
389 0.06
390 0.05