Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BYV5

Protein Details
Accession A0A2H3BYV5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
69-95PENPNRGKAPRPKKKKAAKPGSSSEPSHydrophilic
NLS Segment(s)
PositionSequence
73-88NRGKAPRPKKKKAAKP
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MLKAIKGSSVKAASKASKTKTVKEGKTPREPSKYQQFMSVQLKLWKVQNPDRSATDAMKEVAVIWRDSPENPNRGKAPRPKKKKAAKPGSSSEPSSSSSSPPRSSEQENAPSSDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.45
4 0.5
5 0.52
6 0.54
7 0.58
8 0.63
9 0.61
10 0.64
11 0.7
12 0.68
13 0.75
14 0.76
15 0.74
16 0.73
17 0.71
18 0.67
19 0.68
20 0.66
21 0.56
22 0.55
23 0.48
24 0.47
25 0.49
26 0.45
27 0.36
28 0.34
29 0.35
30 0.3
31 0.32
32 0.29
33 0.29
34 0.34
35 0.38
36 0.38
37 0.39
38 0.39
39 0.39
40 0.36
41 0.31
42 0.26
43 0.19
44 0.16
45 0.13
46 0.12
47 0.09
48 0.1
49 0.1
50 0.09
51 0.08
52 0.09
53 0.1
54 0.11
55 0.16
56 0.18
57 0.24
58 0.25
59 0.28
60 0.31
61 0.33
62 0.4
63 0.45
64 0.51
65 0.56
66 0.65
67 0.71
68 0.77
69 0.85
70 0.87
71 0.89
72 0.89
73 0.87
74 0.84
75 0.82
76 0.8
77 0.74
78 0.66
79 0.57
80 0.49
81 0.43
82 0.4
83 0.34
84 0.29
85 0.33
86 0.36
87 0.37
88 0.38
89 0.4
90 0.41
91 0.45
92 0.48
93 0.49
94 0.52
95 0.51