Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K1F7

Protein Details
Accession B6K1F7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
262-286LAFYRHTYKTPQKKAGKYKQSAVKVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 7, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0034625  P:fatty acid elongation, monounsaturated fatty acid  
GO:0034626  P:fatty acid elongation, polyunsaturated fatty acid  
GO:0019367  P:fatty acid elongation, saturated fatty acid  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MSAPVSLWSLFDNFVYSIVGRRPSNFEFIVGKTHLSTWPVVASIIVGYYTVIFGGQRLMRSHSPIRFNKVFQYYNLVFSLGSLFLALLIFEQVAPIIREHGLFFSICNEQAWTQPLLYLYYLAYISKYLELFDTVFLVLRKKPLQFLHCYHHGATAVLVYSQIMGRTSISWLVIELNLMVHVVMYYYYYLASRGVRVWWKKWVTRFQITQFFTDLVFIYFAVATELMHRAGIRKGCMGHCAGHPLAAFAGVFTLSSYLFLFLAFYRHTYKTPQKKAGKYKQSAVKVIDDKMQNAEIKLVTKNSSLAEVHCNGIVASLCPVTPRTHNDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.18
6 0.24
7 0.23
8 0.26
9 0.32
10 0.33
11 0.39
12 0.35
13 0.34
14 0.32
15 0.32
16 0.35
17 0.29
18 0.27
19 0.22
20 0.24
21 0.23
22 0.21
23 0.21
24 0.16
25 0.16
26 0.16
27 0.15
28 0.13
29 0.11
30 0.09
31 0.08
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.1
42 0.11
43 0.14
44 0.16
45 0.22
46 0.23
47 0.3
48 0.36
49 0.38
50 0.45
51 0.47
52 0.54
53 0.53
54 0.53
55 0.54
56 0.55
57 0.51
58 0.42
59 0.46
60 0.39
61 0.38
62 0.36
63 0.29
64 0.21
65 0.2
66 0.2
67 0.11
68 0.1
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.07
84 0.08
85 0.09
86 0.09
87 0.1
88 0.1
89 0.09
90 0.09
91 0.1
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.13
98 0.15
99 0.14
100 0.12
101 0.13
102 0.13
103 0.13
104 0.13
105 0.11
106 0.08
107 0.08
108 0.09
109 0.07
110 0.07
111 0.06
112 0.07
113 0.08
114 0.08
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.13
127 0.15
128 0.15
129 0.2
130 0.24
131 0.28
132 0.32
133 0.35
134 0.37
135 0.39
136 0.4
137 0.35
138 0.33
139 0.29
140 0.23
141 0.19
142 0.14
143 0.09
144 0.07
145 0.06
146 0.04
147 0.04
148 0.04
149 0.05
150 0.04
151 0.05
152 0.05
153 0.05
154 0.06
155 0.07
156 0.07
157 0.06
158 0.06
159 0.07
160 0.06
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.03
168 0.02
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.05
177 0.06
178 0.07
179 0.07
180 0.08
181 0.11
182 0.18
183 0.21
184 0.23
185 0.3
186 0.34
187 0.37
188 0.43
189 0.49
190 0.5
191 0.53
192 0.56
193 0.53
194 0.58
195 0.55
196 0.5
197 0.42
198 0.35
199 0.29
200 0.25
201 0.19
202 0.1
203 0.09
204 0.08
205 0.07
206 0.06
207 0.06
208 0.06
209 0.06
210 0.05
211 0.06
212 0.08
213 0.07
214 0.08
215 0.08
216 0.09
217 0.13
218 0.16
219 0.16
220 0.17
221 0.2
222 0.21
223 0.24
224 0.24
225 0.22
226 0.2
227 0.25
228 0.22
229 0.21
230 0.2
231 0.18
232 0.16
233 0.14
234 0.13
235 0.07
236 0.07
237 0.05
238 0.05
239 0.04
240 0.05
241 0.04
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.07
248 0.07
249 0.1
250 0.1
251 0.12
252 0.16
253 0.18
254 0.2
255 0.27
256 0.38
257 0.46
258 0.55
259 0.62
260 0.67
261 0.74
262 0.84
263 0.87
264 0.87
265 0.82
266 0.81
267 0.8
268 0.78
269 0.74
270 0.66
271 0.64
272 0.57
273 0.53
274 0.51
275 0.44
276 0.39
277 0.36
278 0.37
279 0.3
280 0.27
281 0.28
282 0.23
283 0.23
284 0.25
285 0.25
286 0.23
287 0.22
288 0.24
289 0.22
290 0.24
291 0.23
292 0.22
293 0.26
294 0.25
295 0.25
296 0.23
297 0.23
298 0.18
299 0.19
300 0.17
301 0.12
302 0.12
303 0.12
304 0.11
305 0.13
306 0.15
307 0.16
308 0.22