Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3C5B2

Protein Details
Accession A0A2H3C5B2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
286-314YGDRHSSSRYDDRRRDRARSRSPRRSRYDBasic
NLS Segment(s)
PositionSequence
298-311RRRDRARSRSPRRS
Subcellular Location(s) cyto_nucl 12.5, nucl 11, cyto 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MGRLAEMQRKLLEQMMGPEAMGVANANLVWSDDKVCRNFLCGTCPHALFTNTKMDLGACPKSHTERLKTEYNAAKEANPNDPIFNRFQMEYESNIFAFVDECDRRIRAAHRRLEKTPEENAKTTNLMKEIAEIELAIQGGTEKIETLGEQGQVDESMREMQAIEALKSEKGEKERELQQLTDTSGASGHQKLRVCDVCGAYLSVLDSDRRLADHFGGKMHLGYHELRNMLAKFREEREKRKAAPPSSAPASGVNGPSGAASGRSGGEYRASRGGDEYRDRDRDRGYGDRHSSSRYDDRRRDRARSRSPRRSRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.21
5 0.19
6 0.15
7 0.13
8 0.12
9 0.07
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.11
19 0.16
20 0.21
21 0.23
22 0.27
23 0.26
24 0.29
25 0.34
26 0.32
27 0.33
28 0.3
29 0.33
30 0.34
31 0.34
32 0.32
33 0.29
34 0.3
35 0.26
36 0.27
37 0.31
38 0.27
39 0.27
40 0.25
41 0.23
42 0.24
43 0.27
44 0.3
45 0.21
46 0.23
47 0.26
48 0.31
49 0.38
50 0.41
51 0.42
52 0.44
53 0.48
54 0.53
55 0.52
56 0.55
57 0.54
58 0.51
59 0.48
60 0.41
61 0.39
62 0.37
63 0.38
64 0.35
65 0.31
66 0.29
67 0.28
68 0.28
69 0.29
70 0.27
71 0.26
72 0.23
73 0.2
74 0.2
75 0.22
76 0.22
77 0.22
78 0.22
79 0.21
80 0.19
81 0.19
82 0.18
83 0.13
84 0.12
85 0.09
86 0.12
87 0.11
88 0.13
89 0.14
90 0.15
91 0.15
92 0.18
93 0.24
94 0.28
95 0.37
96 0.44
97 0.51
98 0.56
99 0.58
100 0.62
101 0.6
102 0.54
103 0.53
104 0.53
105 0.48
106 0.44
107 0.42
108 0.37
109 0.35
110 0.32
111 0.26
112 0.19
113 0.16
114 0.15
115 0.15
116 0.14
117 0.12
118 0.1
119 0.08
120 0.07
121 0.07
122 0.07
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.04
132 0.04
133 0.05
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.08
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.09
155 0.11
156 0.11
157 0.13
158 0.16
159 0.16
160 0.21
161 0.27
162 0.32
163 0.32
164 0.3
165 0.28
166 0.27
167 0.27
168 0.23
169 0.16
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.12
176 0.15
177 0.18
178 0.18
179 0.24
180 0.26
181 0.26
182 0.27
183 0.26
184 0.23
185 0.21
186 0.21
187 0.15
188 0.12
189 0.1
190 0.08
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.09
198 0.1
199 0.12
200 0.16
201 0.17
202 0.16
203 0.17
204 0.17
205 0.16
206 0.15
207 0.13
208 0.12
209 0.13
210 0.15
211 0.17
212 0.17
213 0.17
214 0.21
215 0.21
216 0.22
217 0.22
218 0.22
219 0.23
220 0.27
221 0.37
222 0.39
223 0.46
224 0.51
225 0.57
226 0.58
227 0.63
228 0.68
229 0.61
230 0.63
231 0.59
232 0.57
233 0.53
234 0.49
235 0.42
236 0.34
237 0.34
238 0.29
239 0.26
240 0.19
241 0.15
242 0.14
243 0.13
244 0.12
245 0.09
246 0.07
247 0.06
248 0.07
249 0.08
250 0.09
251 0.1
252 0.1
253 0.16
254 0.17
255 0.2
256 0.25
257 0.25
258 0.24
259 0.27
260 0.3
261 0.31
262 0.36
263 0.38
264 0.4
265 0.47
266 0.49
267 0.49
268 0.48
269 0.46
270 0.45
271 0.49
272 0.46
273 0.49
274 0.52
275 0.54
276 0.53
277 0.52
278 0.48
279 0.47
280 0.52
281 0.52
282 0.57
283 0.61
284 0.69
285 0.75
286 0.81
287 0.84
288 0.83
289 0.85
290 0.85
291 0.87
292 0.89
293 0.89
294 0.92