Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BNK1

Protein Details
Accession A0A2H3BNK1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-72RIACASQPIKRRRRRFEDQHTPHFMGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVVSIGNPQHCCRAYSSVCSERQLACRYESPGTLLGCRNGRFQDYGRIACASQPIKRRRRRFEDQHTPHFMGPDVEPSVLNTAIGPSNVSNHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.44
4 0.44
5 0.45
6 0.46
7 0.45
8 0.4
9 0.43
10 0.41
11 0.35
12 0.31
13 0.32
14 0.33
15 0.32
16 0.28
17 0.25
18 0.24
19 0.23
20 0.22
21 0.2
22 0.2
23 0.22
24 0.23
25 0.23
26 0.2
27 0.21
28 0.2
29 0.2
30 0.26
31 0.26
32 0.25
33 0.24
34 0.23
35 0.22
36 0.2
37 0.24
38 0.18
39 0.19
40 0.27
41 0.35
42 0.44
43 0.54
44 0.63
45 0.67
46 0.74
47 0.8
48 0.82
49 0.84
50 0.85
51 0.84
52 0.83
53 0.81
54 0.74
55 0.65
56 0.55
57 0.44
58 0.35
59 0.27
60 0.23
61 0.18
62 0.16
63 0.15
64 0.16
65 0.18
66 0.16
67 0.15
68 0.11
69 0.11
70 0.12
71 0.12
72 0.12
73 0.1