Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BPA4

Protein Details
Accession A0A2H3BPA4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
138-159LMNSSYRRPRTKRPQPFEYNAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019510  AKAP7-like_phosphoesterase  
IPR009210  ASCC1  
IPR009097  Cyclic_Pdiesterase  
Pfam View protein in Pfam  
PF10469  AKAP7_NLS  
Amino Acid Sequences MARPTHFLSIPLGQTHPTLRARVANLHAALNLPTPDSTLLAGPQRVHLTIGVMNLTPESLPTALDLLHSLPTLLPLTAAPPTITLDTLDVLKRESRRRAHVLWVGPSQPEPLFSQIHQIFRDEGFITDTRPLKLHMTLMNSSYRRPRTKRPQPFEYNAILRQAGVSECFGVQESEYAELPMTVSMGSYEAPRVHLCKMGSWDRDGAYVSCGSAPLFEELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.26
5 0.25
6 0.25
7 0.3
8 0.31
9 0.35
10 0.37
11 0.37
12 0.35
13 0.34
14 0.32
15 0.27
16 0.25
17 0.22
18 0.18
19 0.13
20 0.11
21 0.12
22 0.12
23 0.12
24 0.12
25 0.1
26 0.12
27 0.14
28 0.17
29 0.16
30 0.19
31 0.2
32 0.19
33 0.19
34 0.17
35 0.16
36 0.15
37 0.15
38 0.13
39 0.11
40 0.11
41 0.1
42 0.1
43 0.08
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.08
77 0.08
78 0.11
79 0.16
80 0.21
81 0.29
82 0.32
83 0.38
84 0.43
85 0.44
86 0.48
87 0.49
88 0.45
89 0.42
90 0.39
91 0.33
92 0.28
93 0.26
94 0.21
95 0.15
96 0.14
97 0.11
98 0.12
99 0.12
100 0.12
101 0.2
102 0.2
103 0.23
104 0.22
105 0.22
106 0.2
107 0.19
108 0.21
109 0.14
110 0.12
111 0.12
112 0.12
113 0.12
114 0.15
115 0.17
116 0.15
117 0.15
118 0.17
119 0.16
120 0.17
121 0.19
122 0.17
123 0.2
124 0.2
125 0.22
126 0.27
127 0.25
128 0.26
129 0.31
130 0.35
131 0.39
132 0.43
133 0.52
134 0.57
135 0.68
136 0.77
137 0.77
138 0.8
139 0.8
140 0.81
141 0.75
142 0.7
143 0.63
144 0.53
145 0.47
146 0.37
147 0.28
148 0.23
149 0.19
150 0.13
151 0.11
152 0.1
153 0.08
154 0.08
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.09
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.09
167 0.08
168 0.07
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.09
176 0.1
177 0.13
178 0.15
179 0.17
180 0.18
181 0.22
182 0.22
183 0.24
184 0.3
185 0.36
186 0.37
187 0.38
188 0.39
189 0.35
190 0.36
191 0.34
192 0.27
193 0.22
194 0.2
195 0.17
196 0.14
197 0.14
198 0.13
199 0.11
200 0.12