Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3ALH8

Protein Details
Accession A0A2H3ALH8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-96APHSPRPKRLLKAMKKHKRDGMSBasic
NLS Segment(s)
PositionSequence
78-92PRPKRLLKAMKKHKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVEDLYNLLMYESVYCLAPHLEELFIRDNTYGNDPVNPPVKAFEYGNVAFLNMVSSRRQLRSETTLLKSITLTAPHSPRPKRLLKAMKKHKRDGMSIRFYGYAWTMSLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.12
11 0.16
12 0.15
13 0.16
14 0.15
15 0.15
16 0.16
17 0.2
18 0.19
19 0.15
20 0.17
21 0.17
22 0.21
23 0.25
24 0.24
25 0.2
26 0.2
27 0.21
28 0.2
29 0.2
30 0.17
31 0.18
32 0.18
33 0.19
34 0.17
35 0.15
36 0.13
37 0.12
38 0.12
39 0.07
40 0.08
41 0.07
42 0.09
43 0.12
44 0.14
45 0.15
46 0.15
47 0.19
48 0.23
49 0.27
50 0.3
51 0.29
52 0.32
53 0.31
54 0.3
55 0.26
56 0.22
57 0.19
58 0.16
59 0.16
60 0.16
61 0.19
62 0.25
63 0.34
64 0.35
65 0.4
66 0.45
67 0.51
68 0.5
69 0.58
70 0.62
71 0.64
72 0.73
73 0.78
74 0.81
75 0.81
76 0.85
77 0.82
78 0.76
79 0.74
80 0.73
81 0.72
82 0.7
83 0.64
84 0.58
85 0.52
86 0.46
87 0.4
88 0.32
89 0.23
90 0.14