Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3E3

Protein Details
Accession B6K3E3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSHydrophilic
NLS Segment(s)
PositionSequence
14-40KKAHRNGIKRPQKHRYDSLKFRDAKFR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKFRDAKFRRNQKFANRGTVKALYEAKTAAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.84
9 0.82
10 0.83
11 0.83
12 0.81
13 0.78
14 0.77
15 0.76
16 0.75
17 0.75
18 0.73
19 0.71
20 0.66
21 0.61
22 0.63
23 0.55
24 0.55
25 0.56
26 0.6
27 0.59
28 0.64
29 0.69
30 0.68
31 0.76
32 0.71
33 0.72
34 0.64
35 0.59
36 0.57
37 0.55
38 0.45
39 0.41
40 0.41
41 0.32
42 0.3
43 0.29
44 0.25