Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BMW4

Protein Details
Accession A0A2H3BMW4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-53ERSPLGRAKLRNRRTKKSNKPRRAKSFCVRTRSCHydrophilic
NLS Segment(s)
PositionSequence
25-44GRAKLRNRRTKKSNKPRRAK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MAILRFLGHVDAPSVVQVEERSPLGRAKLRNRRTKKSNKPRRAKSFCVRTRSCGSLFQSTRKAFAAYYTNAFFAMLERLNGRERFKRIGTRSQSTYVMSMGTDKDHACFIKQTGDENGMSFNTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.1
6 0.11
7 0.12
8 0.12
9 0.13
10 0.15
11 0.19
12 0.24
13 0.29
14 0.38
15 0.48
16 0.56
17 0.65
18 0.72
19 0.77
20 0.82
21 0.86
22 0.87
23 0.88
24 0.9
25 0.9
26 0.92
27 0.93
28 0.94
29 0.91
30 0.88
31 0.86
32 0.86
33 0.82
34 0.8
35 0.71
36 0.65
37 0.61
38 0.56
39 0.48
40 0.42
41 0.39
42 0.39
43 0.38
44 0.37
45 0.4
46 0.37
47 0.37
48 0.32
49 0.29
50 0.2
51 0.21
52 0.21
53 0.15
54 0.17
55 0.16
56 0.16
57 0.15
58 0.15
59 0.12
60 0.09
61 0.1
62 0.08
63 0.08
64 0.08
65 0.1
66 0.15
67 0.18
68 0.21
69 0.24
70 0.28
71 0.32
72 0.36
73 0.43
74 0.43
75 0.51
76 0.54
77 0.54
78 0.55
79 0.53
80 0.51
81 0.44
82 0.4
83 0.3
84 0.23
85 0.17
86 0.15
87 0.12
88 0.11
89 0.12
90 0.11
91 0.12
92 0.15
93 0.16
94 0.16
95 0.18
96 0.18
97 0.24
98 0.24
99 0.27
100 0.27
101 0.3
102 0.29
103 0.27
104 0.27
105 0.2