Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JYN3

Protein Details
Accession B6JYN3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
365-390WFVWSKTQHIIDKRRQRRHSINSERNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 6, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023041  Glucose_rcpt_Git3_N  
Gene Ontology GO:0016020  C:membrane  
GO:1990576  F:G protein-coupled glucose receptor activity  
GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0010619  P:adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway  
GO:0010515  P:negative regulation of induction of conjugation with cellular fusion  
Pfam View protein in Pfam  
PF11710  Git3  
Amino Acid Sequences MSYDPTYTGDILVLSLRELKNLRIMVIVASSVSVLFSFGTVVYRVRQRERYFRDHILIALFTTLFFRSIVQIIHPSITINHLLYFVPKWRCFTIGFFLFVFVRMTDYWIFIVVLHNALVVLSKKNITSNNIGLYPYRWWVFALSFILPFGLGGLTFVNRTNTYVNLQTRCFLPLRPVRWMFGFNWSIDYCLSLFILIIHTCMFLSIRKSIRRFKRDTNQHITALEQFDRSLEDQLQNNESSSPSGNTGSSATYQGVSSSSSVSMAAIEADISVNPSAGYTNPELLGDYYHHDPLYQHRRDILRQSKFLFAYPVVFSIMWLLPQLQMIAVLTRRNQCVGACKNFAFVAVFSDNCVTLFLLLCDFIWFVWSKTQHIIDKRRQRRHSINSERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.16
3 0.16
4 0.2
5 0.21
6 0.22
7 0.28
8 0.29
9 0.29
10 0.23
11 0.24
12 0.2
13 0.2
14 0.18
15 0.11
16 0.1
17 0.09
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.08
28 0.1
29 0.14
30 0.21
31 0.26
32 0.33
33 0.41
34 0.46
35 0.56
36 0.62
37 0.66
38 0.67
39 0.67
40 0.64
41 0.56
42 0.52
43 0.43
44 0.35
45 0.27
46 0.21
47 0.16
48 0.11
49 0.12
50 0.11
51 0.09
52 0.09
53 0.09
54 0.1
55 0.12
56 0.12
57 0.13
58 0.17
59 0.17
60 0.18
61 0.17
62 0.16
63 0.14
64 0.17
65 0.17
66 0.13
67 0.13
68 0.13
69 0.13
70 0.14
71 0.16
72 0.21
73 0.26
74 0.27
75 0.3
76 0.31
77 0.33
78 0.33
79 0.34
80 0.35
81 0.3
82 0.3
83 0.26
84 0.26
85 0.24
86 0.23
87 0.21
88 0.12
89 0.12
90 0.1
91 0.13
92 0.12
93 0.13
94 0.12
95 0.12
96 0.12
97 0.1
98 0.12
99 0.09
100 0.09
101 0.08
102 0.08
103 0.07
104 0.07
105 0.08
106 0.07
107 0.08
108 0.09
109 0.1
110 0.11
111 0.14
112 0.17
113 0.19
114 0.23
115 0.24
116 0.26
117 0.26
118 0.26
119 0.23
120 0.22
121 0.2
122 0.18
123 0.16
124 0.13
125 0.12
126 0.13
127 0.13
128 0.14
129 0.14
130 0.12
131 0.12
132 0.11
133 0.11
134 0.09
135 0.08
136 0.06
137 0.04
138 0.03
139 0.03
140 0.04
141 0.04
142 0.05
143 0.06
144 0.08
145 0.08
146 0.1
147 0.11
148 0.12
149 0.13
150 0.19
151 0.22
152 0.23
153 0.23
154 0.23
155 0.22
156 0.24
157 0.22
158 0.17
159 0.2
160 0.24
161 0.26
162 0.32
163 0.33
164 0.31
165 0.32
166 0.34
167 0.27
168 0.28
169 0.26
170 0.19
171 0.21
172 0.2
173 0.19
174 0.17
175 0.16
176 0.1
177 0.08
178 0.08
179 0.05
180 0.05
181 0.04
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.08
192 0.13
193 0.17
194 0.23
195 0.27
196 0.36
197 0.45
198 0.52
199 0.55
200 0.59
201 0.64
202 0.7
203 0.74
204 0.74
205 0.69
206 0.62
207 0.57
208 0.49
209 0.42
210 0.34
211 0.26
212 0.18
213 0.13
214 0.12
215 0.13
216 0.13
217 0.12
218 0.11
219 0.13
220 0.15
221 0.17
222 0.19
223 0.18
224 0.17
225 0.16
226 0.15
227 0.13
228 0.12
229 0.11
230 0.1
231 0.11
232 0.11
233 0.11
234 0.11
235 0.11
236 0.11
237 0.11
238 0.1
239 0.1
240 0.1
241 0.09
242 0.09
243 0.09
244 0.08
245 0.08
246 0.08
247 0.07
248 0.07
249 0.07
250 0.07
251 0.06
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.06
264 0.06
265 0.1
266 0.09
267 0.11
268 0.11
269 0.11
270 0.12
271 0.12
272 0.13
273 0.1
274 0.12
275 0.13
276 0.15
277 0.14
278 0.14
279 0.15
280 0.24
281 0.33
282 0.33
283 0.31
284 0.36
285 0.4
286 0.43
287 0.53
288 0.53
289 0.5
290 0.53
291 0.54
292 0.55
293 0.52
294 0.49
295 0.42
296 0.32
297 0.28
298 0.24
299 0.22
300 0.18
301 0.17
302 0.16
303 0.16
304 0.15
305 0.12
306 0.12
307 0.12
308 0.1
309 0.11
310 0.11
311 0.07
312 0.07
313 0.07
314 0.1
315 0.11
316 0.13
317 0.18
318 0.22
319 0.24
320 0.25
321 0.26
322 0.25
323 0.33
324 0.38
325 0.41
326 0.41
327 0.4
328 0.4
329 0.39
330 0.38
331 0.3
332 0.22
333 0.21
334 0.18
335 0.18
336 0.17
337 0.18
338 0.17
339 0.16
340 0.17
341 0.11
342 0.09
343 0.1
344 0.1
345 0.09
346 0.09
347 0.09
348 0.09
349 0.09
350 0.08
351 0.1
352 0.1
353 0.11
354 0.18
355 0.2
356 0.22
357 0.28
358 0.35
359 0.4
360 0.48
361 0.57
362 0.6
363 0.69
364 0.77
365 0.82
366 0.83
367 0.85
368 0.87
369 0.88
370 0.88