Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CP99

Protein Details
Accession A0A2H3CP99    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
242-261SNSAGDRRGHRRRNADSEDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016069  Translin_C  
IPR002848  Translin_fam  
IPR016068  Translin_N  
IPR036081  Translin_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF01997  Translin  
CDD cd14820  TRAX  
Amino Acid Sequences MTSTTTTIFDAFRQDLDEHNDRRERLIKASRDVTNISKKAIFLLHRIVLEDAPASEGLTPALRAAKRGNESLRQVQQIYANMKGELVGDRFWRYQHQVSPGLQEYIEALSFSHFLEHGTLITFDQVQRTLCDSEGAPYFPLTISDYMLGLSDLTGELMRYSISGLTKRGGRLQAMDTLGFVRNCKADFEGFTPYVRFLSKKQSVTAQSLQKIEDAVYAIVVRSSEYDLPPEMLDDIVSQTFSNSAGDRRGHRRRNADSEDEFDDEAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.29
4 0.36
5 0.33
6 0.4
7 0.44
8 0.42
9 0.46
10 0.49
11 0.44
12 0.45
13 0.52
14 0.5
15 0.52
16 0.58
17 0.56
18 0.53
19 0.54
20 0.52
21 0.53
22 0.48
23 0.44
24 0.39
25 0.36
26 0.35
27 0.36
28 0.31
29 0.25
30 0.3
31 0.3
32 0.29
33 0.3
34 0.29
35 0.24
36 0.22
37 0.18
38 0.12
39 0.1
40 0.1
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.13
49 0.12
50 0.14
51 0.17
52 0.23
53 0.26
54 0.31
55 0.35
56 0.35
57 0.41
58 0.46
59 0.48
60 0.44
61 0.42
62 0.38
63 0.37
64 0.36
65 0.33
66 0.29
67 0.25
68 0.22
69 0.21
70 0.2
71 0.17
72 0.14
73 0.12
74 0.11
75 0.11
76 0.14
77 0.15
78 0.16
79 0.18
80 0.21
81 0.24
82 0.27
83 0.31
84 0.33
85 0.33
86 0.37
87 0.35
88 0.3
89 0.26
90 0.22
91 0.17
92 0.13
93 0.12
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.07
104 0.06
105 0.06
106 0.07
107 0.06
108 0.07
109 0.07
110 0.06
111 0.07
112 0.08
113 0.08
114 0.08
115 0.11
116 0.11
117 0.1
118 0.11
119 0.1
120 0.11
121 0.12
122 0.11
123 0.09
124 0.08
125 0.09
126 0.07
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.03
147 0.04
148 0.05
149 0.07
150 0.09
151 0.1
152 0.12
153 0.15
154 0.16
155 0.2
156 0.2
157 0.19
158 0.2
159 0.21
160 0.24
161 0.23
162 0.22
163 0.18
164 0.17
165 0.19
166 0.17
167 0.16
168 0.12
169 0.13
170 0.13
171 0.14
172 0.14
173 0.13
174 0.15
175 0.17
176 0.21
177 0.21
178 0.21
179 0.2
180 0.19
181 0.19
182 0.18
183 0.17
184 0.14
185 0.24
186 0.3
187 0.32
188 0.33
189 0.39
190 0.41
191 0.47
192 0.51
193 0.48
194 0.44
195 0.44
196 0.42
197 0.36
198 0.32
199 0.26
200 0.2
201 0.15
202 0.11
203 0.1
204 0.1
205 0.09
206 0.09
207 0.08
208 0.07
209 0.07
210 0.1
211 0.12
212 0.13
213 0.15
214 0.16
215 0.17
216 0.17
217 0.16
218 0.14
219 0.11
220 0.11
221 0.09
222 0.1
223 0.09
224 0.1
225 0.09
226 0.09
227 0.09
228 0.1
229 0.11
230 0.1
231 0.12
232 0.17
233 0.22
234 0.28
235 0.38
236 0.48
237 0.55
238 0.62
239 0.7
240 0.73
241 0.79
242 0.8
243 0.78
244 0.71
245 0.67
246 0.63
247 0.56