Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BP68

Protein Details
Accession A0A2H3BP68    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRVHKAQRDVHRATRBasic
73-98VALRSHWRSKVHKRRCKQLKEPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRLRRSRVHKAQRDVHRATRTRVRTKDLDLIQLIDLDPKNRAALEAQPLDFEKPGLAQHYCVECAKYYETDVALRSHWRSKVHKRRCKQLKEPAYTIEESERAAGLGRENRRPAHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.77
5 0.72
6 0.69
7 0.69
8 0.67
9 0.68
10 0.66
11 0.64
12 0.58
13 0.6
14 0.62
15 0.54
16 0.5
17 0.41
18 0.38
19 0.32
20 0.28
21 0.23
22 0.18
23 0.17
24 0.13
25 0.13
26 0.12
27 0.12
28 0.11
29 0.12
30 0.09
31 0.12
32 0.17
33 0.18
34 0.18
35 0.18
36 0.19
37 0.19
38 0.18
39 0.15
40 0.09
41 0.07
42 0.07
43 0.09
44 0.09
45 0.09
46 0.11
47 0.12
48 0.13
49 0.13
50 0.13
51 0.11
52 0.13
53 0.13
54 0.11
55 0.11
56 0.11
57 0.12
58 0.12
59 0.13
60 0.12
61 0.12
62 0.14
63 0.16
64 0.2
65 0.23
66 0.28
67 0.35
68 0.45
69 0.56
70 0.64
71 0.71
72 0.73
73 0.8
74 0.85
75 0.86
76 0.85
77 0.85
78 0.84
79 0.82
80 0.78
81 0.72
82 0.66
83 0.57
84 0.48
85 0.4
86 0.31
87 0.24
88 0.22
89 0.17
90 0.12
91 0.13
92 0.12
93 0.14
94 0.21
95 0.26
96 0.33
97 0.37