Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3C6G8

Protein Details
Accession A0A2H3C6G8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
100-120AKPGGRTKSKHVHKERPETEDBasic
NLS Segment(s)
Subcellular Location(s) mito 18, extr 8
Family & Domain DBs
Amino Acid Sequences MRLSSARSFCVIWTLYFLLAECRPFKLGGAIGALEGAMTGAGIESSAQECPSNPPTLGQVLVRRGKQTVTNQGSGEAGGGSVGGSGSSGGGQTDTIRGSAKPGGRTKSKHVHKERPETEDEGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.18
5 0.16
6 0.17
7 0.2
8 0.16
9 0.17
10 0.18
11 0.18
12 0.18
13 0.18
14 0.17
15 0.15
16 0.15
17 0.13
18 0.12
19 0.12
20 0.11
21 0.07
22 0.06
23 0.04
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.11
38 0.13
39 0.14
40 0.14
41 0.14
42 0.15
43 0.16
44 0.16
45 0.13
46 0.14
47 0.18
48 0.22
49 0.22
50 0.21
51 0.21
52 0.21
53 0.25
54 0.26
55 0.31
56 0.31
57 0.33
58 0.32
59 0.33
60 0.32
61 0.26
62 0.22
63 0.11
64 0.07
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.05
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.12
86 0.17
87 0.21
88 0.27
89 0.32
90 0.38
91 0.44
92 0.49
93 0.54
94 0.6
95 0.65
96 0.69
97 0.73
98 0.77
99 0.8
100 0.87
101 0.84
102 0.8
103 0.75
104 0.69