Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JYR6

Protein Details
Accession B6JYR6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-36VRIGGKGTPRRKVKKPSKAALSAAHydrophilic
NLS Segment(s)
PositionSequence
14-31RIGGKGTPRRKVKKPSKA
Subcellular Location(s) cyto 12.5, cyto_nucl 11.833, nucl 10, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005829  C:cytosol  
GO:0005854  C:nascent polypeptide-associated complex  
GO:0005634  C:nucleus  
GO:0042788  C:polysomal ribosome  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MDSAKLSKLQAGVRIGGKGTPRRKVKKPSKAALSAADEKKVQTSLKKLNMQALAGIQEVNMFKEDGNVINFQAPTVHASLPNETVAIYGKPQEKSFAEILPGVLNNLGPESLAALRKMAEQLKVSEGKADGEAGKDADGDIPDLVEKFDEQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.3
5 0.33
6 0.37
7 0.43
8 0.51
9 0.58
10 0.66
11 0.75
12 0.79
13 0.81
14 0.84
15 0.84
16 0.83
17 0.81
18 0.74
19 0.69
20 0.65
21 0.63
22 0.54
23 0.47
24 0.39
25 0.34
26 0.32
27 0.29
28 0.24
29 0.19
30 0.25
31 0.31
32 0.39
33 0.44
34 0.43
35 0.47
36 0.47
37 0.43
38 0.36
39 0.28
40 0.21
41 0.16
42 0.15
43 0.08
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.07
50 0.08
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.11
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.09
66 0.1
67 0.11
68 0.11
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.1
76 0.14
77 0.15
78 0.16
79 0.19
80 0.18
81 0.22
82 0.23
83 0.19
84 0.17
85 0.16
86 0.16
87 0.14
88 0.13
89 0.09
90 0.08
91 0.07
92 0.06
93 0.06
94 0.05
95 0.04
96 0.04
97 0.06
98 0.08
99 0.1
100 0.1
101 0.1
102 0.1
103 0.12
104 0.16
105 0.16
106 0.17
107 0.18
108 0.2
109 0.25
110 0.27
111 0.26
112 0.26
113 0.24
114 0.22
115 0.21
116 0.2
117 0.15
118 0.14
119 0.15
120 0.13
121 0.12
122 0.11
123 0.11
124 0.11
125 0.11
126 0.1
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.09