Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B496

Protein Details
Accession A0A2H3B496   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
181-217EEEAEGKKRKRPSKKDLDRFKEQKRLKKIAKTAWLRTBasic
NLS Segment(s)
PositionSequence
186-211GKKRKRPSKKDLDRFKEQKRLKKIAK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
Pfam View protein in Pfam  
PF00397  WW  
PROSITE View protein in PROSITE  
PS01159  WW_DOMAIN_1  
PS50020  WW_DOMAIN_2  
Amino Acid Sequences MASPTPPPPEQPETFTSTPEKPSEPPTPEEPSSSSAEATVPTAVAPTNGDWQAIFSPQHNTYYFYNTITAQTTWENPLLPQPQPQSQPEAAASSSSSYDAALAAGIDPSLAYLDPALSAPAGSSSAAYTATAKFNARTGRFTANDARDPTHMSEYERAKRMSEFYFDVGAWESQRDQQQQEEEAEGKKRKRPSKKDLDRFKEQKRLKKIAKTAWLRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.41
4 0.37
5 0.39
6 0.37
7 0.35
8 0.3
9 0.36
10 0.41
11 0.41
12 0.42
13 0.43
14 0.47
15 0.45
16 0.45
17 0.41
18 0.36
19 0.36
20 0.32
21 0.27
22 0.2
23 0.19
24 0.17
25 0.16
26 0.12
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.13
35 0.13
36 0.13
37 0.13
38 0.14
39 0.15
40 0.16
41 0.15
42 0.12
43 0.17
44 0.18
45 0.22
46 0.21
47 0.23
48 0.23
49 0.28
50 0.27
51 0.23
52 0.23
53 0.2
54 0.21
55 0.2
56 0.18
57 0.14
58 0.14
59 0.14
60 0.15
61 0.15
62 0.14
63 0.12
64 0.18
65 0.19
66 0.19
67 0.22
68 0.22
69 0.26
70 0.29
71 0.3
72 0.3
73 0.28
74 0.28
75 0.24
76 0.23
77 0.18
78 0.15
79 0.14
80 0.09
81 0.09
82 0.08
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.02
96 0.03
97 0.02
98 0.02
99 0.02
100 0.03
101 0.03
102 0.03
103 0.04
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.09
118 0.1
119 0.1
120 0.1
121 0.14
122 0.2
123 0.21
124 0.22
125 0.24
126 0.28
127 0.29
128 0.32
129 0.35
130 0.33
131 0.37
132 0.36
133 0.34
134 0.29
135 0.31
136 0.3
137 0.27
138 0.24
139 0.22
140 0.26
141 0.31
142 0.37
143 0.39
144 0.37
145 0.35
146 0.35
147 0.36
148 0.32
149 0.29
150 0.25
151 0.22
152 0.23
153 0.22
154 0.21
155 0.19
156 0.18
157 0.14
158 0.13
159 0.12
160 0.15
161 0.21
162 0.23
163 0.23
164 0.27
165 0.3
166 0.31
167 0.32
168 0.31
169 0.27
170 0.27
171 0.34
172 0.36
173 0.37
174 0.41
175 0.48
176 0.55
177 0.64
178 0.71
179 0.74
180 0.79
181 0.86
182 0.9
183 0.92
184 0.91
185 0.9
186 0.89
187 0.87
188 0.86
189 0.83
190 0.82
191 0.81
192 0.83
193 0.81
194 0.82
195 0.82
196 0.81
197 0.84