Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JVH6

Protein Details
Accession B6JVH6   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
369-399VHSTTNSRCARCKRSKKGCDRERPCGRCRDAHydrophilic
411-432EHPAVTARKPRGRGRGRPKTRABasic
NLS Segment(s)
PositionSequence
418-432RKPRGRGRGRPKTRA
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDLNSILHSNSNAAGIAGSLSHQMNGVSAPYAGHAVPAPNDMQWTQVPGGAYYYPQFAASTATPMLRQLSSQGQVPQYYAVRDKQTASSNMPATQPQHQSQQLPGYGSPQLTSNSLMPNMNNPCADTQSPSTQHVPPLKRMCPSYMEVHNPSVNNDTNASPSFGMPNGYMPSMNGNVRNPLLPSNTLNQGYMGGMPNYPMNFPQQKKLPSETLSDEDVAMQLIRLGEPIMPKFPYGYDNASKLPPVAQLQTIASPSMMAPNGVKVEDMPYGGDSLQRQNLVNAQEGAMKRNRNDYAVPPNDYNPYAPRPMTMPYHDVMGAGFPNIMEQTSGLPMPMPFPVNDLKSAYPPVGNGMPPANGAVPAQVTGPVHSTTNSRCARCKRSKKGCDRERPCGRCRDAGLTSAECVSDDEHPAVTARKPRGRGRGRPKTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.09
15 0.09
16 0.09
17 0.09
18 0.11
19 0.1
20 0.1
21 0.11
22 0.12
23 0.13
24 0.15
25 0.15
26 0.14
27 0.16
28 0.15
29 0.17
30 0.16
31 0.19
32 0.18
33 0.19
34 0.19
35 0.17
36 0.19
37 0.16
38 0.17
39 0.14
40 0.15
41 0.14
42 0.14
43 0.13
44 0.11
45 0.15
46 0.14
47 0.16
48 0.15
49 0.16
50 0.16
51 0.17
52 0.19
53 0.15
54 0.15
55 0.15
56 0.2
57 0.21
58 0.24
59 0.27
60 0.27
61 0.28
62 0.28
63 0.29
64 0.24
65 0.26
66 0.26
67 0.26
68 0.28
69 0.29
70 0.31
71 0.32
72 0.36
73 0.37
74 0.37
75 0.39
76 0.37
77 0.37
78 0.36
79 0.34
80 0.31
81 0.34
82 0.36
83 0.32
84 0.37
85 0.38
86 0.39
87 0.39
88 0.42
89 0.37
90 0.33
91 0.31
92 0.27
93 0.26
94 0.24
95 0.21
96 0.17
97 0.16
98 0.15
99 0.17
100 0.16
101 0.15
102 0.17
103 0.18
104 0.16
105 0.22
106 0.25
107 0.25
108 0.23
109 0.22
110 0.21
111 0.24
112 0.24
113 0.2
114 0.2
115 0.25
116 0.27
117 0.29
118 0.32
119 0.3
120 0.35
121 0.4
122 0.39
123 0.41
124 0.46
125 0.46
126 0.46
127 0.46
128 0.42
129 0.38
130 0.38
131 0.36
132 0.33
133 0.36
134 0.35
135 0.36
136 0.36
137 0.32
138 0.31
139 0.3
140 0.26
141 0.21
142 0.2
143 0.17
144 0.18
145 0.18
146 0.18
147 0.14
148 0.13
149 0.13
150 0.12
151 0.12
152 0.1
153 0.11
154 0.11
155 0.11
156 0.11
157 0.09
158 0.12
159 0.13
160 0.14
161 0.14
162 0.14
163 0.16
164 0.16
165 0.17
166 0.15
167 0.15
168 0.15
169 0.15
170 0.16
171 0.17
172 0.2
173 0.2
174 0.19
175 0.17
176 0.16
177 0.14
178 0.13
179 0.12
180 0.08
181 0.07
182 0.08
183 0.09
184 0.09
185 0.09
186 0.08
187 0.12
188 0.18
189 0.2
190 0.24
191 0.29
192 0.32
193 0.35
194 0.38
195 0.37
196 0.32
197 0.34
198 0.32
199 0.29
200 0.26
201 0.23
202 0.19
203 0.15
204 0.13
205 0.1
206 0.07
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.07
215 0.08
216 0.09
217 0.1
218 0.1
219 0.1
220 0.1
221 0.11
222 0.12
223 0.16
224 0.16
225 0.18
226 0.2
227 0.2
228 0.19
229 0.17
230 0.16
231 0.14
232 0.13
233 0.12
234 0.11
235 0.12
236 0.13
237 0.14
238 0.13
239 0.11
240 0.09
241 0.08
242 0.07
243 0.09
244 0.08
245 0.07
246 0.07
247 0.09
248 0.1
249 0.09
250 0.09
251 0.07
252 0.09
253 0.09
254 0.1
255 0.08
256 0.08
257 0.09
258 0.09
259 0.1
260 0.09
261 0.12
262 0.14
263 0.15
264 0.15
265 0.15
266 0.19
267 0.19
268 0.2
269 0.17
270 0.15
271 0.19
272 0.19
273 0.22
274 0.22
275 0.23
276 0.22
277 0.29
278 0.3
279 0.28
280 0.3
281 0.32
282 0.38
283 0.4
284 0.43
285 0.36
286 0.37
287 0.37
288 0.35
289 0.31
290 0.25
291 0.24
292 0.24
293 0.23
294 0.22
295 0.21
296 0.24
297 0.26
298 0.25
299 0.24
300 0.21
301 0.23
302 0.22
303 0.2
304 0.17
305 0.14
306 0.11
307 0.08
308 0.08
309 0.06
310 0.06
311 0.06
312 0.07
313 0.05
314 0.05
315 0.07
316 0.08
317 0.09
318 0.08
319 0.08
320 0.08
321 0.1
322 0.11
323 0.11
324 0.1
325 0.13
326 0.18
327 0.18
328 0.21
329 0.22
330 0.21
331 0.23
332 0.25
333 0.23
334 0.19
335 0.17
336 0.19
337 0.19
338 0.18
339 0.17
340 0.17
341 0.16
342 0.16
343 0.17
344 0.13
345 0.11
346 0.11
347 0.1
348 0.09
349 0.09
350 0.09
351 0.1
352 0.1
353 0.11
354 0.13
355 0.13
356 0.13
357 0.14
358 0.18
359 0.18
360 0.28
361 0.33
362 0.34
363 0.41
364 0.49
365 0.59
366 0.66
367 0.74
368 0.76
369 0.81
370 0.88
371 0.92
372 0.94
373 0.94
374 0.94
375 0.92
376 0.91
377 0.91
378 0.88
379 0.83
380 0.82
381 0.76
382 0.72
383 0.68
384 0.65
385 0.56
386 0.53
387 0.52
388 0.43
389 0.39
390 0.33
391 0.29
392 0.21
393 0.2
394 0.17
395 0.14
396 0.16
397 0.16
398 0.15
399 0.16
400 0.17
401 0.19
402 0.23
403 0.28
404 0.34
405 0.4
406 0.47
407 0.55
408 0.65
409 0.72
410 0.78
411 0.81
412 0.83